DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and kat-60L1

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001163523.1 Gene:kat-60L1 / 40715 FlyBaseID:FBgn0037375 Length:673 Species:Drosophila melanogaster


Alignment Length:184 Identity:39/184 - (21%)
Similarity:63/184 - (34%) Gaps:57/184 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 VDNSLDVYFVPAFNGLYAPY---WNQDARGVICGLSEETTSEHIVRATLEAVCFQVRDILDSMHK 423
            |:..:.|.|||.:.  :.||   |:...    |..:..|:..|:.|            ::||:..
  Fly    79 VEYEVAVPFVPTYR--HTPYHSLWDLHQ----CSSTPPTSLSHMAR------------MMDSLIL 125

  Fly   424 DCKIPLA----------------KLMVDGGMT--------VNNLFLQLQSDL-VGIQV-LRAKIA 462
            |...|..                |...:||.:        ||||.......| :|..| ||:|..
  Fly   126 DSLSPFGFTKITATSRPSRNASLKKSSEGGHSSTAERHRPVNNLGSNAPGGLGIGGSVPLRSKQR 190

  Fly   463 ETTALGAA-MAAYKAVENRYQMEAPLSKSGPR---------EAIKPSISATDRN 506
            ..|.:.|| :|.........||..|..:...|         ..::|::.:.:.|
  Fly   191 LPTQVSAAEVAPQPRASQTAQMPFPSQQQDNRWVSSLRRRDPELQPTLPSINSN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 39/184 (21%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 39/184 (21%)
kat-60L1NP_001163523.1 AAA 426..565 CDD:214640
AAA 430..563 CDD:278434
Vps4_C <638..671 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.