DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and psmc2

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_957260.1 Gene:psmc2 / 393941 ZFINID:ZDB-GENE-040426-1327 Length:433 Species:Danio rerio


Alignment Length:121 Identity:31/121 - (25%)
Similarity:45/121 - (37%) Gaps:20/121 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 LAKLMVDGGMTVNNLFLQLQSDLVGIQVLRAKIAETTAL-----GAAMAA---YKAVENRYQMEA 485
            :|.|...|..|.:....|::.|   ||.|..||.|.|.:     |.|..|   ..|.:...|.|.
Zfish    30 IALLKTYGQSTYSRQIKQVEDD---IQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQ 91

  Fly   486 PLSKSGPREAIKPSISATDRNLRY-----QKWKMAIDRSLNWETSTLPQGEREAFD 536
            ||..:    .....|:|...:.:|     |..|..:|.|.....:.:.:|.|...|
Zfish    92 PLQVA----RCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVD 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 28/105 (27%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 28/105 (27%)
psmc2NP_957260.1 RPT1 23..430 CDD:224143 31/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.