DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and CG3544

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001259842.1 Gene:CG3544 / 33252 FlyBaseID:FBgn0031279 Length:572 Species:Drosophila melanogaster


Alignment Length:470 Identity:99/470 - (21%)
Similarity:156/470 - (33%) Gaps:124/470 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LVAVGGKVEEIITIGITNQRESTVVWDR--------------------NSGQPLVNAIIWLDNRT 126
            ||..|..:..:::|....|:...|.|..                    .|...|.....|.|:.|
  Fly    83 LVKQGADMHTVVSIAGAAQQHGCVFWSELGLRRLCNLNVNLRLHEQITESAFELTRTPTWRDSST 147

  Fly   127 TSTVEELLETIPNNARNINYLRPLCGLPLSPYFSGVKLRWLRDNVPVVSQAME--KGTAMFGTID 189
            ...|.|:..|:...|.    |..:.|......|:|.::|      .|.:|..|  :.|:....|.
  Fly   148 DVQVREMEHTVGGPAE----LSKITGSRAYTRFTGPQIR------KVYTQCPEQYERTSRISLIS 202

  Fly   190 TWLMYNLTGGKDCGVHKTDVTNASRTMLMNIETLQWDANLLKFFG--LPKTILPEICSSSEFYGS 252
            ::|...|.|    |:...|.::.|...|::|...:|.|..|....  |.:.::..|.||.     
  Fly   203 SFLASLLIG----GIASIDYSDGSGMNLLDIRKKKWSAACLDACAPDLARRLMKPIPSSR----- 258

  Fly   253 IAQGVLQG-IG--------------ITSVLGDQQAALVGQQCLAKGQAKATYGTGCFLLYNTGPS 302
                 ||| ||              :.:..|.:.:.|.|  .|.:..         ||:.:...|
  Fly   259 -----LQGRIGDYYVKRWNFRPDCMVVASTGSKASELAG--LLVEND---------FLMLSLDTS 307

  Fly   303 IV------------------HSTH-----GLLTTVGYQLGRKAVPFYALEGSVSIAGAAFNWLRD 344
            .|                  |.|.     |||......|.|||:       ...:||.::....:
  Fly   308 DVVVMPLKKAPRLEDGHVMCHPTRRDEYMGLLCFQNGGLTRKAI-------CEDVAGGSWRHFYE 365

  Fly   345 NMNLIQ--NSGQIETMASTVDNSLDVYFVPAFNGLYAPYWNQD----ARGVICGLSEETTSEHIV 403
            .::...  |:|.:..      :..|...:|...|...  |:..    :...|.||...:|.|..|
  Fly   366 MLDATPSGNNGNVAV------HFRDREIIPTAKGTLR--WDAHISPMSAECIRGLHRFSTPEIEV 422

  Fly   404 RATLEAVCFQVRDILDSM--HKDCKIPLAKLMVDGGMTVNNLFLQLQSDLVGIQVLRAKIAETTA 466
            ||.:|........|...|  |   ..|..|::|.|..:.....||:.:|:....|.:....|.:.
  Fly   423 RALIEGQIMHHWSIAHEMGFH---HTPNTKIIVVGEDSRCQSVLQIVADIFNAPVYQRTGVEVSL 484

  Fly   467 LGAAM-AAYKAVENR 480
            ||.|. |.|...|:|
  Fly   485 LGCAFRARYAFYEHR 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 99/470 (21%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 99/470 (21%)
CG3544NP_001259842.1 FGGY_D-XK_euk 13..493 CDD:212660 96/462 (21%)
XylB 15..494 CDD:273550 96/463 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10196
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.