DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and Atad2

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001128351.1 Gene:Atad2 / 314993 RGDID:1304849 Length:1373 Species:Rattus norvegicus


Alignment Length:357 Identity:75/357 - (21%)
Similarity:127/357 - (35%) Gaps:100/357 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 GVHKTDVTNASRTMLMNIETLQWDANL--------------LKFFGLPKTILPEICSSSE----- 248
            |::|..:...:.  |.:::.:|.|:::              ||...|...:.||:....:     
  Rat   384 GIYKDRMKIGAN--LADVDPMQLDSSVRFDSVGGLSSHIAALKEMVLFPLLYPEVFEKFKIQPPR 446

  Fly   249 ---FYGSIAQG---VLQGIGITSVLGDQQAALV---GQQCLAK--GQAKATYGTGCFLLYNTGPS 302
               |||....|   |.:.:......||::.|..   |..||:|  |:::...             
  Rat   447 GCLFYGPPGTGKTLVARALANECSRGDKRVAFFMRKGADCLSKWVGESERQL------------- 498

  Fly   303 IVHSTHGLLTTVGYQLGRKAVPFYALEGSVSIAGAAFNWLRDNMNLIQNSGQIETMASTVDNSLD 367
                  .||....||: |.|:.|             |:.: |.:..:::|.|.:..:|.|...|.
  Rat   499 ------RLLFDQAYQM-RPAIIF-------------FDEI-DGLAPVRSSRQDQIHSSIVSTLLA 542

  Fly   368 VYFVPAFNGLYAPYWNQDARGVICGLSEETTSEHIVRATLEAVCFQVRDILDSM-HKDCKIPLAK 431
            :     .:||       |:||.|..:......:.|..|......|. |:.|.|: .||.:..:.|
  Rat   543 L-----MDGL-------DSRGEIVVIGATNRLDSIDPALRRPGRFD-REFLFSLPDKDARKEILK 594

  Fly   432 LMV-DGGMTVNNLFL-QLQSDLVGIQVLRAKIAETTALGA------AMAAYKAVENRYQMEAPLS 488
            :.. |......::|| :|..:.||.            .||      |.||..|:..||......|
  Rat   595 IHTRDWNPKPVDMFLEELAENCVGY------------CGADIKSICAEAALCALRRRYPQIYTTS 647

  Fly   489 KSGPREAIKPSISATDRNLRYQKWKMAIDRSL 520
            :....:....:|||.|.....||...|..|::
  Rat   648 EKLQLDLSSINISAKDFETAMQKIIPASQRAV 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 75/357 (21%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 75/357 (21%)
Atad2NP_001128351.1 AAA 444..585 CDD:214640 39/187 (21%)
AAA 449..583 CDD:278434 38/180 (21%)
Bromo_AAA 972..1082 CDD:99957
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.