DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and CG10793

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_570054.2 Gene:CG10793 / 31308 FlyBaseID:FBgn0029656 Length:479 Species:Drosophila melanogaster


Alignment Length:271 Identity:58/271 - (21%)
Similarity:100/271 - (36%) Gaps:58/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 PLCGLPLSPYFSGVKL-RW----------LRDNVPVVSQAMEKGTAMFGTIDTWLMYNLTGGKDC 202
            |...||..|..:...| .|          |.:..|:..:.||..|...|..:...:.::..|.| 
  Fly   113 PAKELPKKPPTTDASLANWHIGVGAATQALSNEQPLQIKKMETATESNGQDNACEIEHVHLGGD- 176

  Fly   203 GVHKTDVTNASRTMLMNIETLQWD--ANLLKFFGLPKTI---LPEICSSSEFYGSIAQGVLQGIG 262
                 ||..:|         |:|.  |.|:|...|.:.|   ..::|.:......|.:.||..|.
  Fly   177 -----DVLFSS---------LEWQSLAELVKTSILQENIKIKWSDVCGNQRAIELIKEAVLTPIE 227

  Fly   263 ITSV----LGDQQAALV------GQQCLAKGQAKATYGTGCFLLYNTGPSIVHS-----THGLLT 312
            ...:    |...::.|:      |:..|||.....|.|...|  :|...||:.|     :..:|.
  Fly   228 FPQLFAHGLKPWRSLLLHGPPGSGKTLLAKALYSETQGQVTF--FNITASIMVSKWRGESEKILR 290

  Fly   313 TVGYQLGRKA---VPFYALEGSVSIAGAAFNWLRDNMNLIQNSGQIETMASTVDNSLDVYFVPAF 374
            .:.:...::|   :.|..:|...|....|    .|:.:..:...::..:...:::||:..||.|.
  Fly   291 VLFHMAAKRAPSVIFFDEIESLTSKRDRA----TDHESSKRFKNELLQLLDGMEHSLNGVFVLAS 351

  Fly   375 NGLYAPYWNQD 385
            ..|  | |:.|
  Fly   352 TNL--P-WDID 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 58/271 (21%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 58/271 (21%)
CG10793NP_570054.2 LisH 31..56 CDD:285685
P-loop_NTPase 205..>259 CDD:304359 11/53 (21%)
AAA 238..376 CDD:214640 28/131 (21%)
AAA 242..374 CDD:278434 28/127 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.