DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and Katnal1

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001006957.1 Gene:Katnal1 / 288449 RGDID:1359252 Length:488 Species:Rattus norvegicus


Alignment Length:116 Identity:27/116 - (23%)
Similarity:41/116 - (35%) Gaps:38/116 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LRPLCGLP--LSPYFSGVKLRWLRDNVPVVSQAMEKGTAMFGTIDTWLMYNLTGGK--------- 200
            ||....||  :..:|.|::..|             ||..|.|...|        ||         
  Rat   218 LREAVVLPMWMPDFFKGIRRPW-------------KGVLMVGPPGT--------GKTMLAKAVAT 261

  Fly   201 DCGVHKTDVTNASRTMLMNIETLQWDANLLKF--FGLPKTI----LPEICS 245
            :||....:|::::.|.....|:.:....|.:.  |..|.||    :..|||
  Rat   262 ECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFYAPTTIFIDEIDSICS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 27/116 (23%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 27/116 (23%)
Katnal1NP_001006957.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..179
RecA-like_KTNA1 207..376 CDD:410930 27/116 (23%)
AAA_lid_3 400..444 CDD:407720
Vps4_C <448..486 CDD:401324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.