DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and Katna1

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_035965.2 Gene:Katna1 / 23924 MGIID:1344353 Length:493 Species:Mus musculus


Alignment Length:200 Identity:38/200 - (19%)
Similarity:64/200 - (32%) Gaps:87/200 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 SEHIVRATLEAVCFQ-----VRDILDSM---------HKDCKIPLAKLMVD----GGMTVNN--- 442
            ||.:||...|...|.     ..|.:||:         |:..:...|:|:|.    ||.:.|:   
Mouse   288 SEKLVRLLFEMARFYSPATIFIDEIDSICSRRGTSEEHEASRRMKAELLVQMDGVGGASENDDPS 352

  Fly   443 --------------------------LFLQLQS-----DLVGIQVLRAKIAETTAL--------- 467
                                      :::.|.|     :|:.|.:...::|:...|         
Mouse   353 KMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLRELELADDVNLASIAENMEG 417

  Fly   468 ------------GAAMAAYKAVE----------NRYQMEAPLSKSGPREAIK---PSISATDRNL 507
                        .:.||..:.:|          :|..|..|.:......|:|   .|:||.|.. 
Mouse   418 YSGADITNVCRDASLMAMRRRIEGLTPEEIRNLSREAMHMPTTMEDFEMALKKISKSVSAADIE- 481

  Fly   508 RYQKW 512
            ||:||
Mouse   482 RYEKW 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 37/199 (19%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 37/199 (19%)
Katna1NP_035965.2 AAA 243..384 CDD:214640 16/95 (17%)
AAA 247..383 CDD:278434 16/94 (17%)
Vps4_C <458..491 CDD:286426 10/29 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.