DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and rpt-2

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_504558.1 Gene:rpt-2 / 178988 WormBaseID:WBGene00004502 Length:443 Species:Caenorhabditis elegans


Alignment Length:188 Identity:31/188 - (16%)
Similarity:64/188 - (34%) Gaps:72/188 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VGAIDEGTTSARFII-FRAGTDEIVCFHQIEVESIFQKEGWCEQDP--MAIVNTVNECITG---- 77
            ||:::|.......|: ...|::     |.:.:.|...||   :.:|  ..::|..|..:.|    
 Worm   112 VGSLEEIIDDQHAIVSTNVGSE-----HYVNIMSFVDKE---QLEPGCSVLLNHKNHAVIGVLSD 168

  Fly    78 ------ACKKL--------VAVGG------KVEEIITIGITNQRESTVVWDRNSGQPLVNAIIW- 121
                  :..||        ..|||      :::|.:.:.:|:..    .::....:|....|:: 
 Worm   169 DTDPMVSVMKLEKAPQETYADVGGLDQQIQEIKEAVELPLTHPE----YYEEMGIRPPKGVILYG 229

  Fly   122 ------------LDNRTTST--------------------VEELLETIPNNARNINYL 147
                        :.|:|::|                    |.||......||.:|.::
 Worm   230 CPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPKMVRELFRVAEENAPSIVFI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 31/188 (16%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 31/188 (16%)
rpt-2NP_504558.1 PTZ00361 1..443 CDD:185575 31/188 (16%)
Prot_ATP_ID_OB 112..>179 CDD:293059 13/74 (18%)
AAA 225..358 CDD:278434 10/63 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.