DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and C10G11.8

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001379656.1 Gene:C10G11.8 / 172324 WormBaseID:WBGene00015688 Length:438 Species:Caenorhabditis elegans


Alignment Length:291 Identity:58/291 - (19%)
Similarity:93/291 - (31%) Gaps:109/291 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EEIIT---------IGITNQRESTVVWDRNSGQPLVNAIIWLDNRTTSTVEELLE------TIPN 139
            :|.||         :.:..:||..:|.... |.|          .|.:.|.||.:      .:..
 Worm    64 KEFITRQTSRHGRPLAVQKRREQQLVQSLR-GTP----------TTLARVHELFDDEKHAVVVVE 117

  Fly   140 NARNINYLRPLCGLPLSPYFSGVKLRWLRDNVPVVSQA--MEK--GTAMFGTIDTWLMYNLTGGK 200
            .:|...|:         |..|.|....||.|..|:.:|  |.|  .:|:.|.:|..:..|..|  
 Worm   118 GSRREWYV---------PILSIVDKDLLRLNALVMVKAGGMFKTVPSAIVGVLDDKIDSNAMG-- 171

  Fly   201 DCGVHKTDVTNASRTMLMNIETLQWDANLLKFFGLPKTILPEI--CSSS---------------E 248
                ||.:.|                         ||....:|  |.|.               |
 Worm   172 ----HKVEKT-------------------------PKETFDDIGGCESQIQELKESVELPLTHPE 207

  Fly   249 FYGSIAQGVLQGIGITS----VLGDQQAALVGQQCLAKGQAKATYGTGCFLLYNTGPSIVHSTHG 309
            :|        :.:|||:    :|..:..  .|:..|||..|.:|..|   .:..||..:|....|
 Worm   208 YY--------EEMGITAPKGVILYGEPG--TGKTLLAKAVANSTSAT---FIRATGSDLVQKQSG 259

  Fly   310 ----LLTTVGYQLGRKAVPFYALEGSVSIAG 336
                |:..: :|:.::..|.......:...|
 Worm   260 EGARLVRQI-FQMAKEQAPSIVFIDEIDAVG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 58/291 (20%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 58/291 (20%)
C10G11.8NP_001379656.1 PTZ00361 9..437 CDD:185575 58/291 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.