DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and KATNA1

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_008975.1 Gene:KATNA1 / 11104 HGNCID:6216 Length:491 Species:Homo sapiens


Alignment Length:209 Identity:48/209 - (22%)
Similarity:77/209 - (36%) Gaps:84/209 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 TNQRESTVVWDRNSGQPLVNAII-------WLDNRTTSTVEELLETIPNNARNINYLRPLCGLP- 154
            ||:.:|| .:|::..:.|...||       |.|      :.:|:|     |:.:  |:....|| 
Human   179 TNKFDST-GYDKDLVEALERDIISQNPNVRWDD------IADLVE-----AKKL--LKEAVVLPM 229

  Fly   155 -LSPYFSGVKLRWLRDNVPVVSQAMEKGTAMFGTIDTWLMYNLTGGK---------DCGVHKTDV 209
             :..:|.|::..|             ||..|.|...|        ||         :|   ||..
Human   230 WMPEFFKGIRRPW-------------KGVLMVGPPGT--------GKTLLAKAVATEC---KTTF 270

  Fly   210 TNASRTMLMN--------IETLQWDANLLKFFGLPKTI----LPEICS----SSEFYGS------ 252
            .|.|.:.|.:        :..|.::  :.:|:. |.||    :..|||    |.|...|      
Human   271 FNVSSSTLTSKYRGESEKLVRLLFE--MARFYS-PATIFIDEIDSICSRRGTSEEHEASRRVKAE 332

  Fly   253 -IAQGVLQGIGITS 265
             :.|  :.|:|.||
Human   333 LLVQ--MDGVGGTS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 48/209 (23%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 48/209 (23%)
KATNA1NP_008975.1 Interaction with microtubules 1..185 2/5 (40%)
Interaction with dynein and NDEL1. /evidence=ECO:0000250 1..75
Interaction with KATNB1. /evidence=ECO:0000269|PubMed:10751153 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..185 2/5 (40%)
AAA 241..382 CDD:214640 30/133 (23%)
AAA 245..381 CDD:278434 27/116 (23%)
Vps4_C <456..489 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.