DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF1 and khdrbs2

DIOPT Version :9

Sequence 1:NP_524654.2 Gene:SF1 / 43912 FlyBaseID:FBgn0025571 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001070758.1 Gene:khdrbs2 / 768147 ZFINID:ZDB-GENE-061013-497 Length:346 Species:Danio rerio


Alignment Length:220 Identity:70/220 - (31%)
Similarity:109/220 - (49%) Gaps:40/220 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 RVSDKVLIPQEQHPDINFVGLLIGPRGNTLKAMEKDTGAKIIIRGKGSVKE-GKVG--RKDGQPL 451
            ::|::||||.:|:|..||||.|:|||||::|.::::||||:.|.||||::: ||..  ||.|:..
Zfish    59 KLSERVLIPVQQYPKFNFVGKLLGPRGNSMKRLQEETGAKMSILGKGSMRDKGKEEELRKSGEAK 123

  Fly   452 PGE-DEPLHAFIT--APNPEAVRK---AVDKIKDVIRQGIEVPEGHNDLRRMQLRELAQLNG--- 507
            ... ...||..|.  ||..||..:   |:::||..:     ||:.::::|:.|||||:.|||   
Zfish   124 YAHLSNDLHVLIEVFAPPGEAYSRMSHALEEIKKFL-----VPDYNDEIRQEQLRELSYLNGSDD 183

  Fly   508 -----TLRENDIQRCTCGSTDHKSWQCPDKP-----------IITNTIVCTSCGGTGHLTKDCRN 556
                 :.|...::..:..|...:....|..|           :.:.|.|.|...|.     ....
Zfish   184 PSRGRSARGRGLRLTSTASPRGRGSAAPPAPPGRGAAAPRGTVSSRTSVPTPARGV-----SAPR 243

  Fly   557 KRPGSGVPGMACEDSQA--KIDEEY 579
            .|..:|.||......||  |..|:|
Zfish   244 TRGTAGTPGYRAPSLQATHKTYEDY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF1NP_524654.2 MSL5 253..512 CDD:227503 54/138 (39%)
SF1-HH 274..385 CDD:292892
SF1_like-KH 392..510 CDD:239088 53/134 (40%)
khdrbs2NP_001070758.1 Qua1 6..57 CDD:292891
SF1_like-KH 61..180 CDD:239088 51/123 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..292 21/99 (21%)
Sam68-YY <281..>306 CDD:293176
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.