DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF1 and how

DIOPT Version :9

Sequence 1:NP_524654.2 Gene:SF1 / 43912 FlyBaseID:FBgn0025571 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster


Alignment Length:465 Identity:106/465 - (22%)
Similarity:183/465 - (39%) Gaps:151/465 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 AQQEAYLVQFQIE-EISRKLRTGDLGITQNPEERSP-----SPEPIYSSDGKRLNTRE------- 353
            |||:....|.|.: :..::.:...:.:...|:..:|     |.:.|.....:.|..|:       
  Fly    30 AQQQQAQAQAQAQAQAQQQQQAPQVVVPMTPQHLTPQQQQQSTQSIADYLAQLLKDRKQLAAFPN 94

  Fly   354 -FRYRKR-LEEQRHQLIVKMQTVNPEFKPPADYKPP---VTRVSDKVLIPQEQHPDINFVGLLIG 413
             |.:.:| |:|:..::...:..:|...|.|.....|   |..:::||.:|..:|||.||||.::|
  Fly    95 VFTHVERLLDEEIARVRASLFQINGVKKEPLTLPEPEGSVVTMNEKVYVPVREHPDFNFVGRILG 159

  Fly   414 PRGNTLKAMEKDTGAKIIIRGKGSVKEGKV-----GRKDGQPLPGEDEPLHAFITAPNPE--AVR 471
            |||.|.|.:|::||.||::|||||:::.|.     |:.:.:.|   .:.||..||..:.|  |..
  Fly   160 PRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHL---SDDLHVLITVEDTENRATV 221

  Fly   472 KAVDKIKDVIRQGIEVPEGHNDLRRMQLRELAQLNGTLRE---NDIQRCTC-GSTDH-------K 525
            |....:.:|.:..:...||.::|::.||.|||.:|||.|:   ..:...:| ||..:       :
  Fly   222 KLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYRDTTAKSVAAFSCVGSASYLYPAVCDE 286

  Fly   526 SWQ----CPDKPIITNTIVCTSCGGTGHLTKDCRNKRPGSGVPGMACEDSQAKIDEEYMSLMAEL 586
            .|:    ..|..::|:|                       |:||:|     |:|           
  Fly   287 EWRRLVAASDSRLLTST-----------------------GLPGLA-----AQI----------- 312

  Fly   587 GEGPPPPSASAKTDPPASNGPQLHRASYSIFDKKPSQMQAI---QSPPSSSSRDHQRDLGGWGAA 648
             ..|    |:|....|....|::         ..|:...:|   |:.|:::              
  Fly   313 -RAP----AAAPLGAPLILNPRM---------TVPTTAASILSAQAAPTAA-------------- 349

  Fly   649 AHEHGMGMEHGMGLDQHGHGL----------AAM----------DHGMSLGMEHAMAA-----YV 688
                         .||.|||:          ||:          ||..::..:..:|.     |.
  Fly   350 -------------FDQTGHGMIFAPYDYANYAALAGNPLLTEYADHSGAIKQQRRLATNREHPYQ 401

  Fly   689 PAPPGTQAPP 698
            .|..|..|.|
  Fly   402 RATVGVPAKP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF1NP_524654.2 MSL5 253..512 CDD:227503 69/237 (29%)
SF1-HH 274..385 CDD:292892 18/97 (19%)
SF1_like-KH 392..510 CDD:239088 48/124 (39%)
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 8/47 (17%)
SF1_like-KH 139..260 CDD:239088 48/123 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460719
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.