DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF1 and qki2

DIOPT Version :9

Sequence 1:NP_524654.2 Gene:SF1 / 43912 FlyBaseID:FBgn0025571 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_021335713.1 Gene:qki2 / 393815 ZFINID:ZDB-GENE-040426-1462 Length:341 Species:Danio rerio


Alignment Length:282 Identity:76/282 - (26%)
Similarity:133/282 - (47%) Gaps:57/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 ERSPSPEPIY----SSDGKRLNTRE-----FRYRKRLEEQRHQLIVK---MQTVNPEFKPPADYK 385
            :..|.|.|.|    .:|.|.:::..     |.:.:||.::....:.|   ..|:|..........
Zfish     8 KEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEIGRVRKDMYNDTLNGSTDKRTSEL 72

  Fly   386 P----PVTRVSDKVLIPQEQHPDINFVGLLIGPRGNTLKAMEKDTGAKIIIRGKGSVKEGKV--- 443
            |    |:.::.:|:.:|.:::||.||||.::||||.|.|.:|.:||.||::|||||:::.|.   
Zfish    73 PDAVGPIAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQ 137

  Fly   444 --GRKDGQPLPGEDEPLHAFITAPNPE-----AVRKAVDKIKDVIRQGIEVPEGHNDLRRMQLRE 501
              |:.:.:.|   :|.||..||..:.:     .:::||:::|.::   :...||.:.|::|||.|
Zfish   138 NRGKPNWEHL---NEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLME 196

  Fly   502 LAQLNGTLRENDIQRCTCGSTDHKSWQCP-----DKPIITNTIVCTSC----------------- 544
            ||.||||.|:.:|:......:...:.|.|     ..|::.|..:.|..                 
Zfish   197 LAILNGTYRDANIKSPALAFSLAATAQAPRIMTGPTPVMPNAALRTPAPTAPTLMPLIRQIQTSA 261

  Fly   545 ---GGTGHLTKDCRNKRPGSGV 563
               .||.|.|.....:.|.||:
Zfish   262 LMPTGTPHPTATLLPQTPESGI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF1NP_524654.2 MSL5 253..512 CDD:227503 63/204 (31%)
SF1-HH 274..385 CDD:292892 12/63 (19%)
SF1_like-KH 392..510 CDD:239088 48/127 (38%)
qki2XP_021335713.1 STAR_dimer 10..68 CDD:318695 12/57 (21%)
SF1_like-KH 83..205 CDD:239088 48/127 (38%)
PRK00708 139..299 CDD:331498 37/151 (25%)
Quaking_NLS 314..341 CDD:293159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.