DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF1 and nsr

DIOPT Version :9

Sequence 1:NP_524654.2 Gene:SF1 / 43912 FlyBaseID:FBgn0025571 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster


Alignment Length:347 Identity:74/347 - (21%)
Similarity:141/347 - (40%) Gaps:92/347 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 PEERSPSPEPIYSSDGKRLNTREFRYRKRLEEQRHQLIVKM--------QTVN----------PE 377
            |.:..|:.:|       |||....::...|:|:|.:|..:.        ::|:          .|
  Fly    16 PTQDQPTYQP-------RLNEVAQKFLADLDEERKRLSAEFPLCALLIDESVDRVFSTGRIPGKE 73

  Fly   378 FKPPADYKPPVTRVSDKVLIPQEQHPDINFVGLLIGPRGNTLKAMEKDTGAKIIIRGKGSVKEGK 442
            |.....::.|: :::.||.:|..:.|..||...::||:||:::.::::|..||:|:|:.|:::  
  Fly    74 FYADVYHQRPM-KITQKVFVPVNKFPKFNFARKILGPKGNSVRRLKEETNCKIVIKGRSSMRD-- 135

  Fly   443 VGRKDGQPLPGEDEPLHAFI----------TAPNPEAVRKAVDKIKDVIRQGIEVPEGHNDLRRM 497
              |...:.|....:|.:|.:          .||..|...:....:.: ||:.: :|:.::|:...
  Fly   136 --RNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAE-IRKYL-IPDDNDDVWHE 196

  Fly   498 QLRELAQLN--GTLRENDIQRCTCGSTDHKSWQCPDKPIITNTIVCTSCGG--------TGHLTK 552
            |.|||.::|  ...:.|.:.            ..|.:.|...||     ||        ...:.:
  Fly   197 QQRELMEMNPESAKKSNGLN------------MAPYRSIFDKTI-----GGNRNGAPKYNNQIRR 244

  Fly   553 DCRNKRPGSGVPGMACEDSQAKIDEEYM-----SLMAELGEGPPPPSASAKTDPPASNGPQLHRA 612
            ...|.|..:.:     |:.:...||..|     ||..|..:  ||||.:|....|       .:.
  Fly   245 VTENPREVADM-----EEVEYDYDEHRMPPSRPSLGFEYSK--PPPSMTATNATP-------FKR 295

  Fly   613 SYSIFDKKPSQMQAIQSPPSSS 634
            :|..    |:.|...:.||..|
  Fly   296 AYPY----PTDMNRTREPPIKS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF1NP_524654.2 MSL5 253..512 CDD:227503 46/210 (22%)
SF1-HH 274..385 CDD:292892 13/71 (18%)
SF1_like-KH 392..510 CDD:239088 32/129 (25%)
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 31/124 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460732
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.