DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF1 and CG4021

DIOPT Version :9

Sequence 1:NP_524654.2 Gene:SF1 / 43912 FlyBaseID:FBgn0025571 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster


Alignment Length:355 Identity:70/355 - (19%)
Similarity:133/355 - (37%) Gaps:114/355 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 QNPE---ERSPSPEPIYSSDGKRLNTREFRYRKRLEEQRHQLIVKM-----------QTVNPEFK 379
            :||.   |..|:....|.   .|||....::...|:|:|.:|..:.           ..|....:
  Fly     5 ENPSEITEEQPTTTHEYQ---PRLNEIAQKFLADLDEERQRLSAEFPLCALLIDEARDRVYATGR 66

  Fly   380 PP-----AD-YKPPVTRVSDKVLIPQEQHPDINFVGLLIGPRGNTLKAMEKDTGAKIIIRGKGSV 438
            .|     || |:....::..||.:|..|:|..||.|.::||:||:|:.::::|..||.::|:.|:
  Fly    67 IPGKELYADVYRQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSM 131

  Fly   439 KEGKVGRKDGQPLPGEDEPLHAFI---------TAPNPEAVRKAVDKIKDVIRQGIEVPEGHNDL 494
            ::    |...:.|  ..:|.:|.:         |...|......:......||:.: :|:.::::
  Fly   132 RD----RNKEEEL--RSDPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYL-IPDNNDEV 189

  Fly   495 RRMQLRELAQLNGTLRENDIQRCTCGSTDHKSWQCPDKPIITNTIVCTSCGGTGHLTKDCRNKRP 559
            ...|||||.:::....:|                                 ..|...:..|:.|.
  Fly   190 SHEQLRELMEIDPESAKN---------------------------------FKGLNLEAYRSVRD 221

  Fly   560 GSGVPGMACEDSQAKIDEEYMSLMAELGEGPPPPSASAKTD--------PPASNGPQLHRAS--- 613
            .:|.             .:|::|:..:.|.|...:...:.|        ||      :|..:   
  Fly   222 SNGA-------------SKYINLIKRVAENPSKVADMEQVDYDYDEHHMPP------IHLPTGYE 267

  Fly   614 YSI---------FDKK---PSQMQAIQSPP 631
            |||         |.:.   |:.|:.::.||
  Fly   268 YSIQRPSKIVAKFKRPYPYPTDMKPVREPP 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF1NP_524654.2 MSL5 253..512 CDD:227503 49/211 (23%)
SF1-HH 274..385 CDD:292892 16/75 (21%)
SF1_like-KH 392..510 CDD:239088 32/126 (25%)
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 32/122 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460731
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.