DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF1 and F54D1.1

DIOPT Version :9

Sequence 1:NP_524654.2 Gene:SF1 / 43912 FlyBaseID:FBgn0025571 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_502114.1 Gene:F54D1.1 / 186227 WormBaseID:WBGene00010046 Length:278 Species:Caenorhabditis elegans


Alignment Length:360 Identity:80/360 - (22%)
Similarity:133/360 - (36%) Gaps:117/360 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 PFDTSNSRNSLNQDHDQSRIPSLFDRQQGLETIREEGREQRFDLTQTIQELMGNAGG--NKGFAS 244
            |.|..|:|..|:::     |..:||                        ||..:..|  :.|:.|
 Worm    24 PIDCKNARMLLSKE-----ISKVFD------------------------ELYRHGQGFIDNGYGS 59

  Fly   245 FFNSQNSNDSTSNGAFDNSADSAAERKRKRKSRWGGSENDKTFIPGMPTILPSTLDPAQQEAYLV 309
            .:   |.||..|    .:||:|            |.|.:.....|.:|....||           
 Worm    60 DY---NKNDFYS----PHSANS------------GYSASPFPSRPSLPNHALST----------- 94

  Fly   310 QFQIEEISRKLRTGDLGITQNPEERSPSPEPIYSSDGKRLNTREFRYRKRLEEQRHQLIVKMQTV 374
            .|........:|.|.:        |||..:   ..|..         |:::.:.:|.|..|:.. 
 Worm    95 SFYHNSFMTPIRNGRM--------RSPDQD---LGDWS---------REKINDTQHVLQTKVYI- 138

  Fly   375 NPEFKPPADYKPPVTRVSDKVLIPQEQHPDINFVGLLIGPRGNTLKAMEKDTGAKIIIRGKGSVK 439
             ||        |||:....||        ..|::|.::||.|.:.:.:|......::|||.|||:
 Worm   139 -PE--------PPVSIDGKKV--------KCNYIGRILGPSGMSARMIENQYDVTLLIRGAGSVR 186

  Fly   440 EGKVG---RKDGQPLPGEDEPLHAFITAPN------PEAVRKAVDKIKDVIRQGIEVPEGHNDLR 495
            ...:.   ||..:.|   :||||..:.|.:      .|.:.||.:||:.::     .|. |::.:
 Worm   187 NKAMDERVRKRNEHL---EEPLHVLLIARHNDKTKCEEILNKAAEKIESLL-----TPI-HDEYK 242

  Fly   496 RMQLRELAQLNGTLRENDIQRCTCGSTDHKSWQCP 530
            ..||...|::|||.:|...::.......|.::..|
 Worm   243 MDQLVSYAKMNGTYQERPKRKSQLDEQSHSNYWAP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF1NP_524654.2 MSL5 253..512 CDD:227503 62/267 (23%)
SF1-HH 274..385 CDD:292892 19/110 (17%)
SF1_like-KH 392..510 CDD:239088 35/126 (28%)
F54D1.1NP_502114.1 SF1_like-KH 133..257 CDD:239088 41/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.