DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF1 and Khdrbs2

DIOPT Version :9

Sequence 1:NP_524654.2 Gene:SF1 / 43912 FlyBaseID:FBgn0025571 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_573498.1 Gene:Khdrbs2 / 170771 MGIID:2159649 Length:349 Species:Mus musculus


Alignment Length:445 Identity:107/445 - (24%)
Similarity:168/445 - (37%) Gaps:162/445 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 QEAYLVQFQIEEISRKLRTGDLGITQNPEERSPSPEPIYSSDGKRLNTREFRYRKRLEEQRHQLI 368
            :|.||.:...|:.|.     |..........:...|....||||          |..||:::..:
Mouse     3 EEKYLPELMAEKDSL-----DPSFVHASRLLAEEIEKFQGSDGK----------KEDEEKKYLDV 52

  Fly   369 VKMQTVNPEFKPPADYKPPVTRVSDKVLIPQEQHPDINFVGLLIGPRGNTLKAMEKDTGAKIIIR 433
            :..:.:               ::|::||||.:|:|..||||.|:|||||:||.::::||||:.|.
Mouse    53 ISNKNI---------------KLSERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSIL 102

  Fly   434 GKGSV----KEGKVGRKDGQPLPGE-DEPLHAFIT--APNPEAVRK---AVDKIKDVIRQGIEVP 488
            ||||:    ||.:: ||.|:..... .:.||..|.  ||..||..:   |:::||..:     ||
Mouse   103 GKGSMRDKTKEEEL-RKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFL-----VP 161

  Fly   489 EGHNDLRRMQLRELAQLNGTLRENDIQRCTCGSTDHKSWQCPDKPIITNTIVCTSCGGTG-HLTK 552
            :.::::|:.|||||:.|||: .|:...|                          ...|.| .:|.
Mouse   162 DYNDEIRQEQLRELSYLNGS-EESGRGR--------------------------GIRGRGIRITP 199

  Fly   553 DCRNKRPGSGVPGMACEDSQAKIDEEYMSLMAELGEGPPPPSASAKTD------------PPASN 605
            ...::..|..||                        .||||.....|.            ||.:.
Mouse   200 TAPSRGRGGAVP------------------------PPPPPGRGVLTPRGTTVTRGALPVPPIAR 240

  Fly   606 GPQLHRASYSIFDKKPSQMQAIQSPPSSSSRDHQRDLGGWGAAAHEHGMGMEHGMGLDQ------ 664
            |....||      :..:.:...::|| ..:.|...:.|      ::.|.|.|:.   ||      
Mouse   241 GVPTPRA------RGTAAVPGYRAPP-PPAHDAYEEYG------YDDGYGGEYD---DQTYEAYD 289

  Fly   665 ---------------HGHGLAAMDHGMSLGMEHAMAAYVPAPPGT-----QAPPP 699
                           :|||:          .|.|..:|.|....|     :||||
Mouse   290 NSYVTPTQSVPEYYDYGHGV----------NEDAYDSYAPEEWATTRSSLKAPPP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF1NP_524654.2 MSL5 253..512 CDD:227503 68/217 (31%)
SF1-HH 274..385 CDD:292892 14/80 (18%)
SF1_like-KH 392..510 CDD:239088 54/127 (43%)
Khdrbs2NP_573498.1 Qua1 6..57 CDD:292891 13/65 (20%)
SF1_like-KH 61..180 CDD:239088 52/124 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..263 20/139 (14%)
Sam68-YY 267..321 CDD:293176 13/72 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..349 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.