DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and SKS1

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_015299.1 Gene:SKS1 / 856081 SGDID:S000005947 Length:502 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:77/255 - (30%)
Similarity:121/255 - (47%) Gaps:54/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 REIQ-NLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELF------DYIVKHGKLQEHQARRFF 132
            |||. .|::..|.:|:|::||:.:....|::|:|.. .:||      .:.|.||.|    .::.|
Yeast   108 REIAFQLRVQSHGNIVKIHQVLESSIATFIVMDYYD-RDLFTSIVDDKHFVNHGIL----IKKVF 167

  Fly   133 QQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGEFLRTS-C-GSPNYAAPE 195
            .|:.|.:|:|||..|.|.|:||||:|||.|.:..:.|||||.   ..::|..: | ||..|.|||
Yeast   168 LQLCSALDHCHRLGIYHCDIKPENVLLDRNDNAYLCDFGLST---KSKYLAPNVCVGSSYYMAPE 229

  Fly   196 VISGKLYA------GPEV------------DIWSCGVILYALLCGTLPFDDEH--VPTLFR---- 236
            .|   ||.      |..|            ||||.|:||..|.|...|:...|  ....|:    
Yeast   230 RI---LYCLNTTTNGIHVDECCSSLPTDTGDIWSLGIILINLTCIRNPWLKAHQKEDNTFQHFAN 291

  Fly   237 --KIKSGIFPIPEYLNKQVVNLVCQMLQVDPLKRANIE----EIKKHEWFQKDLPAYLFP 290
              .:...|.||.:    ::..::.::||::|..|.:::    |:.....|.::.|....|
Yeast   292 DNNVLKKILPISD----ELFTVLTKILQLNPYTRIDMKTLMSEVSSLTSFTREGPLSQVP 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 74/243 (30%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
SKS1NP_015299.1 PKc_like 9..331 CDD:419665 73/237 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345335
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.