DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and NPR1

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_014216.1 Gene:NPR1 / 855538 SGDID:S000005127 Length:790 Species:Saccharomyces cerevisiae


Alignment Length:392 Identity:100/392 - (25%)
Similarity:146/392 - (37%) Gaps:112/392 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AAG--------SANGQPLVKIGH----------YL-LGATLGTGTFGKVK----IGEHQITRVK- 53
            |||        :.||..:....|          |: .||.||.|..|.||    |.:::|..|| 
Yeast   404 AAGNNSYSTSYNGNGDTIYSHSHGGSGIPFSKRYIKTGADLGAGAGGSVKLAQRISDNKIFAVKE 468

  Fly    54 VAVKILNRQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIV 118
            ...|..|..|   .|.|.||..|........||:||:..:::.....|..:|||.. .:|| .||
Yeast   469 FRTKFENESK---RDYVKKITSEYCIGTTLNHPNIIETIEIVYENDRILQVMEYCE-YDLF-AIV 528

  Fly   119 KHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFG--------LSNM 175
            ...|:...:....|:||::||.|.|...:.|||||.:|.:::....||:.|||        .|..
Yeast   529 MSNKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVINEKGIVKLIDFGAAVVFSYPFSKN 593

  Fly   176 MLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALL-------------------- 220
            :::...:   .||..|.||||.....|....|||||..:|...::                    
Yeast   594 LVEASGI---VGSDPYLAPEVCIFAKYDPRPVDIWSSAIIFACMILKKFPWKIPKLRDNSFKLFC 655

  Fly   221 ----CGTL----------PFDDEHVPTLFRKIKSG-----------------IFPIPEYLNKQVV 254
                |.:|          |..||...|..:|.:|.                 :..:||    :..
Yeast   656 SGRDCDSLSSLVTRTPDPPSYDESHSTEKKKPESSSNNVSDPNNVNIGPQRLLHSLPE----ETQ 716

  Fly   255 NLVCQMLQVDPLKRANIEEIKKHEWFQKDLPAYLFPSSIEQDSNVIDTYAVAEVCTKFGVKETEV 319
            ::|.:|:.:.|..|.|||||.:..|.:.                 ||...:.|....|.|...|.
Yeast   717 HIVGRMIDLAPACRGNIEEIMEDPWIRS-----------------IDMCHLVEDGLSFKVVRGED 764

  Fly   320 HN 321
            |:
Yeast   765 HH 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 87/329 (26%)
UBA_AID_AMPKalpha 297..360 CDD:270521 7/25 (28%)
AMPKA_C 457..580 CDD:213378
NPR1NP_014216.1 PKc_like 451..742 CDD:419665 79/302 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.