DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and PRR1

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_012806.1 Gene:PRR1 / 853744 SGDID:S000001599 Length:518 Species:Saccharomyces cerevisiae


Alignment Length:301 Identity:79/301 - (26%)
Similarity:126/301 - (41%) Gaps:84/301 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LGTGTFGKV-----------KIGEHQITRVKVAVKILNRQKIKS--------LDVVGKIRREIQN 79
            :|:|.|..|           |:.:..:.|:|...::.|.::|.:        ..:...:.||:|.
Yeast   198 IGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQV 262

  Fly    80 LKLFRHPHIIKLY----------------QVISTPSDI---FMIMEYVSGGELFDYIV-KHGKLQ 124
            ||...||.|:||.                .:|.||..:   .|||.|...|:|...:: ::|:|:
Yeast   263 LKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLE 327

  Fly   125 EHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNM----------------HVKIADFGLS 173
            ....:|.|.:::..|.|.|.:.|:|||||.||:||.::.                .:::|||||.
Yeast   328 AWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLC 392

  Fly   174 NMMLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKI 238
            ..:.:.|.....|||.:|.:||::.|..|.|...|.|:.|||||:|....||||           
Yeast   393 KKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFD----------- 446

  Fly   239 KSGIFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHEW 279
                 |.|....:|             ..||....|.:.:|
Yeast   447 -----PPPNASARQ-------------RSRATSHRIARFDW 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 79/301 (26%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
PRR1NP_012806.1 S_TKc 192..508 CDD:214567 79/301 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.