DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and KKQ8

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_012753.2 Gene:KKQ8 / 853686 SGDID:S000001651 Length:724 Species:Saccharomyces cerevisiae


Alignment Length:318 Identity:76/318 - (23%)
Similarity:137/318 - (43%) Gaps:56/318 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GHYLLGATLGTGTFGKVKI--------------GEHQITRVKVAVKILNRQKIKSLDVVGKIRRE 76
            ||.:  ..:|.|.:|:||:              ..|....:..|||.|..:....|:   |...:
Yeast   412 GHPV--GLVGAGAYGEVKLCARLRNEKDSPPFETYHDSKYIYYAVKELKPKPDSDLE---KFCTK 471

  Fly    77 IQNLKLFRH-------------PHIIKLYQVISTPSDIFMIMEYVSGGELFDYIV----KHGKLQ 124
            |.:..:..|             |:|:.::.::...|....:||:...|:|:..:|    ..|:|.
Yeast   472 ITSEFIIGHSLSHYHKNGKKPAPNILNVFDILEDSSSFIEVMEFCPAGDLYGMLVGKSKLKGRLH 536

  Fly   125 EHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGEFLRTSC--- 186
            ..:|..|.:|::.||.:.|.|.|.|.||||||:|...:..:||.|||.|::.......|...   
Yeast   537 PLEADCFMKQLLHGVKFMHDHGIAHCDLKPENILFYPHGLLKICDFGTSSVFQTAWERRVHAQKG 601

  Fly   187 --GSPNYAAP-EVISGKLYAGPEVDIWSCGVILYALLCGTLPFD----------DEHVPTLFRKI 238
              ||..|.|| |.:.|:.|....:|.|||||:...::.|...:.          ||....:.||.
Yeast   602 IIGSEPYVAPEEFVDGEYYDPRLIDCWSCGVVYITMILGHYLWKVASREKDMSYDEFYKEMQRKN 666

  Fly   239 KSGIFPIPEYLNKQVVN----LVCQMLQVDPLKRANIEEIKKHEWFQKDLPAYLFPSS 292
            :..:|...:::|.::..    .:.::.|.:|.||.::.::...:|.:......::.|:
Yeast   667 QFRVFEELKHVNSELATNRKIALYRIFQWEPRKRISVGKLLDMQWMKSTNCCLIYDST 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 74/304 (24%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
KKQ8NP_012753.2 PKc_like 418..712 CDD:419665 72/296 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345339
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.