DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and HAL5

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_012370.1 Gene:HAL5 / 853274 SGDID:S000003701 Length:855 Species:Saccharomyces cerevisiae


Alignment Length:339 Identity:86/339 - (25%)
Similarity:134/339 - (39%) Gaps:98/339 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LGTGTFGKVKIGEHQITRVKVAVKIL------NRQK----IKSLD-------------------- 68
            :|.|.:|.|||    ..|.|.|..:|      |.:|    :|.|.                    
Yeast   509 VGAGAYGVVKI----CARCKTAKDVLPYSTYSNGKKLFFAVKELKPKPGDQIDKFCTRLTSEFII 569

  Fly    69 --------------VVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYI-- 117
                          :.|.:.|......:|..|:|:|:..::...:....:||:.:.|:|:..:  
Yeast   570 GHSLSHPHFEANAMIAGNVSRTTPPKHVFNAPNILKILDLMEYSNSFVEVMEFCASGDLYSLLTR 634

  Fly   118 -----------------VKHGK---LQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHN 162
                             ||.|.   |...:|..|.:|:::||.|.|.|.|.|.||||||:|...|
Yeast   635 NNISNESNNGSSRLIQTVKEGSGSPLHPLEADCFMKQLLNGVQYMHDHGIAHCDLKPENILFQPN 699

  Fly   163 MHVKIADFGLSNMMLDG-----EFLRTSCGSPNYAAP-EVISGKLYAGPEVDIWSCGVILYALLC 221
            ..:||.|||.|::....     .|...:.||..|.|| |.|....|....||.||||::...::.
Yeast   700 GLLKICDFGTSSVFQTAWEKHVHFQSGAMGSEPYVAPEEFIRDAEYDPRLVDCWSCGIVYCTMVM 764

  Fly   222 G------TLPFDDEHVPTLFRKIK-SGIFPIPEYLNKQVVNLVCQM-----------LQVDPLKR 268
            |      .:|..|....:...:|| .|.|    ||.:::.::..::           .||||.||
Yeast   765 GQYLWKIAIPEKDSLFKSFLSEIKDDGQF----YLFEELRHVSSELNRLRKIALYRTFQVDPTKR 825

  Fly   269 ANIEEIKKHEWFQK 282
            ..||::.:..|.:|
Yeast   826 ITIEQLLQSSWMRK 839

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 84/335 (25%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
HAL5NP_012370.1 PKc_like 509..837 CDD:419665 84/335 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.