DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and VHS1

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_010533.1 Gene:VHS1 / 851834 SGDID:S000002655 Length:461 Species:Saccharomyces cerevisiae


Alignment Length:334 Identity:86/334 - (25%)
Similarity:142/334 - (42%) Gaps:94/334 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KIGHYLLGATLGTGTFGKV--------------------------------KIGEHQITRVKVAV 56
            :|.:||:.:.:|.|.:|.|                                ||.::.:...|...
Yeast     8 RINNYLITSQIGEGAYGLVYRALDIRTDRQYAIKAVVQSYGVSKEADMGNDKIHKNSVKLQKKLA 72

  Fly    57 KILNRQK----IKSLDVVGKIRREIQN------------------LKLFRHPHIIKLYQVISTPS 99
            |:....|    :.|:|:     ..|:|                  |::..|.:|:.:::|:.:..
Yeast    73 KLFKESKNVVRVPSIDL-----ESIENMSEEDFKKLPHYKEISLHLRVHHHKNIVTIHEVLQSAV 132

  Fly   100 DIFMIMEYVSGGELFDYIV--KHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHN 162
            ..|::|:|.. .:||..||  :|........::.|.||.|.::|||.|.|.|.|:||||||||..
Yeast   133 CTFIVMDYYP-TDLFTSIVDNRHFVTNGLLVKKVFLQICSALNYCHEHGIYHCDIKPENLLLDTE 196

  Fly   163 MHVKIADFGLSNMMLDGEFLRTS-C-GSPNYAAPEVIS---------------GKLYAGPEVDIW 210
            .:|.:.|||||.   ...:::.: | ||..|..||.||               ||:......|:|
Yeast   197 DNVFLCDFGLST---TSTYIKPNVCIGSSYYMPPERISFDGRVSSSKSGGHKLGKVCPSCNGDLW 258

  Fly   211 SCGVILYALLCGTLPF-----DDEHVPTLFRK---IKSGIFPIPEYLNKQVVNLVCQMLQVDPLK 267
            |.|:||..|.|...|:     .:::....|.|   |...|.|    |:....:|:.::|||:|..
Yeast   259 SLGIILINLTCIRNPWLKADKTEDNTYYYFTKDPNILKQILP----LSDDFYSLLSKILQVNPKN 319

  Fly   268 RANIEEIKK 276
            |.:::|:.|
Yeast   320 RMSLQELMK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 86/333 (26%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
VHS1NP_010533.1 STKc_Pat1_like 11..330 CDD:270895 85/331 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.