DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and PRR2

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_010067.1 Gene:PRR2 / 851312 SGDID:S000002373 Length:699 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:71/307 - (23%)
Similarity:130/307 - (42%) Gaps:68/307 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LGATLGTGTFGKVKIGEHQITRVKVAVKILNRQKIKSLDVVGKIRREIQNL-------KLFRHPH 87
            |...||.|:.||||:.:..:.....|:|....:|.:..:     |:.|:|:       ...::|:
Yeast   363 LDVVLGEGSGGKVKLVQRVLDNKVFALKEYRSKKKRESE-----RKYIKNIISEYCIASTLKNPN 422

  Fly    88 IIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDL 152
            |.:..:::.....||.|:||.. .:||..::.. |:...:....|:|:|:||.|.|...:.||||
Yeast   423 ICETLEILYEKGKIFQILEYCE-YDLFSLVMSE-KMHYEEICCLFKQLINGVKYLHDIGLSHRDL 485

  Fly   153 KPENLLLDHNMHVKIADFG--------LSNMMLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDI 209
            |.:|.::.....:|:.|||        ||:.|::...:   .||..|.:|||.....|....:|:
Yeast   486 KLDNCVVTRRGILKLIDFGASSVFHYPLSSQMIEANGI---VGSDPYLSPEVFYFNEYDPRALDV 547

  Fly   210 WSCGVILYALLCGTLPFDDEHVPTL-FRKIKSG-------------------------------- 241
            ||.|:|.:.::....|:....|..: |:...||                                
Yeast   548 WSVGIIFFCMITRRFPWKYPKVKDVQFKAFCSGRGVSSFKDLVTRPATDDSNNYDNDGYEEGVID 612

  Fly   242 ------IFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHEWFQK 282
                  :..:||..:|    ::.::|:|.|.:|..|..|.:..|.::
Yeast   613 MGPNFILHRLPEETHK----IMRRILEVSPFRRITINGILQDGWIKE 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 70/303 (23%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
PRR2NP_010067.1 PKc_like 367..653 CDD:419665 69/299 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345342
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.