DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and SNRK2.5

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_201170.1 Gene:SNRK2.5 / 836485 AraportID:AT5G63650 Length:360 Species:Arabidopsis thaliana


Alignment Length:264 Identity:113/264 - (42%)
Similarity:160/264 - (60%) Gaps:14/264 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LGTGTFGKVKIGEHQITRVKVAVKILNR-QKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVIST 97
            ||.|.||..::..|:.|:..||:|.:.| :||..     .:.|||.|.:..|||:||:..:||.|
plant    10 LGAGNFGVARLLRHKETKELVAMKYIERGRKIDE-----NVAREIINHRSLRHPNIIRFKEVILT 69

  Fly    98 PSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHN 162
            |:.:.::|||.||||||:.|...|:..|.:||.||||:|.||||||...|.|||||.||.|||.:
plant    70 PTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQICHRDLKLENTLLDGS 134

  Fly   163 MH--VKIADFGLSNMMLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLP 225
            ..  :||.|||.|...|.....:::.|:|.|.||||:|.:.|.|...|:|||||.||.:|.|..|
plant   135 PAPLLKICDFGYSKSSLLHSRPKSTVGTPAYIAPEVLSRREYDGKHADVWSCGVTLYVMLVGGYP 199

  Fly   226 FDDEHVPTLFRK----IKSGIFPIPEY--LNKQVVNLVCQMLQVDPLKRANIEEIKKHEWFQKDL 284
            |:|...|..|||    |.:..:.||:|  ::::..:|:.::...:..||..::|||||.|:.|:|
plant   200 FEDPDDPRNFRKTIQRIMAVQYKIPDYVHISQECRHLLSRIFVTNSAKRITLKEIKKHPWYLKNL 264

  Fly   285 PAYL 288
            |..|
plant   265 PKEL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 108/254 (43%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
SNRK2.5NP_201170.1 STKc_SnRK2 3..259 CDD:271132 108/253 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24343
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.