DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and CIPK21

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_568860.1 Gene:CIPK21 / 835868 AraportID:AT5G57630 Length:416 Species:Arabidopsis thaliana


Alignment Length:327 Identity:125/327 - (38%)
Similarity:185/327 - (56%) Gaps:36/327 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILNRQKIKSLDVVGKIRREIQNLKLFRHPHI 88
            |||.|.:|.|:|.|.|.|||:|........|||||:::..:....:..:::|||:.:||..||:|
plant     8 KIGKYEIGRTIGEGNFAKVKLGYDTTNGTYVAVKIIDKALVIQKGLESQVKREIRTMKLLNHPNI 72

  Fly    89 IKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLK 153
            :::::||.|.:.|.::|||||||:|.|.:.:. |::|..||:.|||:|..|||||...:.|||||
plant    73 VQIHEVIGTKTKICIVMEYVSGGQLSDRLGRQ-KMKESDARKLFQQLIDAVDYCHNRGVYHRDLK 136

  Fly   154 PENLLLDHNMHVKIADFGLSNMMLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYA 218
            |:|||||...::|::|||||.:...|:.|.|:||||.|.|||:|..|.|:|..||:|||||||:.
plant   137 PQNLLLDSKGNLKVSDFGLSAVPKSGDMLSTACGSPCYIAPELIMNKGYSGAAVDVWSCGVILFE 201

  Fly   219 LLCGTLPFDDEHVPTLFRKIKSGIFPIPEYLNKQVVNLVCQMLQVDPLKRANIEE-IKKHEWFQ- 281
            ||.|..||||..:|.|::||....:..|.....:...|:..:|..:||.|..:.| |.|..||: 
plant   202 LLAGYPPFDDHTLPVLYKKILRADYTFPPGFTGEQKRLIFNILDPNPLSRITLAEIIIKDSWFKI 266

  Fly   282 -------------KDLPAYLFPSSIEQDSNVIDTYAVAEVC------------------TKFGVK 315
                         ||..|.:  ::....||.|:.:.:..:.                  |:.|.|
plant   267 GYTPVYHQLSDSIKDNVAEI--NAATASSNFINAFQIIAMSSDLDLSGLFEENDDKRYKTRIGSK 329

  Fly   316 ET 317
            .|
plant   330 NT 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 112/255 (44%)
UBA_AID_AMPKalpha 297..360 CDD:270521 7/39 (18%)
AMPKA_C 457..580 CDD:213378
CIPK21NP_568860.1 PKc_like 11..263 CDD:419665 110/252 (44%)
CIPK_C 297..411 CDD:213380 4/35 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000976
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.