DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and SNRK2.7

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_195711.1 Gene:SNRK2.7 / 830162 AraportID:AT4G40010 Length:350 Species:Arabidopsis thaliana


Alignment Length:353 Identity:125/353 - (35%)
Similarity:181/353 - (51%) Gaps:40/353 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LGTGTFGKVKIGEHQITRVKVAVKILNRQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTP 98
            ||:|.||..|:...:......|||.:.|    .|.:...::|||.|.:..:||:||:..:|..||
plant    10 LGSGNFGVAKLVREKANGEFYAVKYIER----GLKIDEHVQREIINHRDLKHPNIIRFKEVFVTP 70

  Fly    99 SDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLD--H 161
            :.:.::|||.:|||||:.|...|:..|.:.|.:|:|:||||.|||...|.|||||.||.|||  .
plant    71 THLAIVMEYAAGGELFERICNAGRFSEDEGRYYFKQLISGVSYCHAMQICHRDLKLENTLLDGSP 135

  Fly   162 NMHVKIADFGLSNMMLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPF 226
            :.|:||.|||.|...:.....:::.|:|.|.||||:|.|.|.|...|:|||||.||.:|.|..||
plant   136 SSHLKICDFGYSKSSVLHSQPKSTVGTPAYVAPEVLSRKEYNGKIADVWSCGVTLYVMLVGAYPF 200

  Fly   227 DDEHVPTLFR----KIKSGIFPIPEY--LNKQVVNLVCQMLQVDPLKRANIEEIKKHEWFQKDLP 285
            :|...|...|    :|.|..:.||:|  ::.:..:|:.::...||.||..:.||:||.||.|. |
plant   201 EDPEDPRNIRNTIQRILSVHYTIPDYVRISSECKHLLSRIFVADPDKRITVPEIEKHPWFLKG-P 264

  Fly   286 AYLFPSSIEQDSNVIDTYAVAEVC-------------TKFGVKETEVHN--SLLSG--DPHDQLA 333
            ..:.|...:.|:.|.:.....|.|             .:.||..|:.:.  .|:.|  |..|   
plant   265 LVVPPEEEKCDNGVEEEEEEEEKCRQSVEEIVKIIEEARKGVNGTDNNGGLGLIDGSIDLDD--- 326

  Fly   334 IAYHLIIDNKRFADDAANQINEINNFFV 361
                  ||:....||..:. .|.|..||
plant   327 ------IDDADIYDDVDDD-EERNGDFV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 101/253 (40%)
UBA_AID_AMPKalpha 297..360 CDD:270521 16/79 (20%)
AMPKA_C 457..580 CDD:213378
SNRK2.7NP_195711.1 STKc_SnRK2 3..259 CDD:271132 101/252 (40%)
S_TKc 4..260 CDD:214567 101/253 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24343
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.