DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and OST1

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_567945.1 Gene:OST1 / 829541 AraportID:AT4G33950 Length:362 Species:Arabidopsis thaliana


Alignment Length:270 Identity:114/270 - (42%)
Similarity:162/270 - (60%) Gaps:14/270 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YLLGATLGTGTFGKVKIGEHQITRVKVAVKILNR-QKIKSLDVVGKIRREIQNLKLFRHPHIIKL 91
            |.|...:|:|.||..::...:.:...||||.:.| :||..     .::|||.|.:..|||:|::.
plant    21 YELVKDIGSGNFGVARLMRDKQSNELVAVKYIERGEKIDE-----NVKREIINHRSLRHPNIVRF 80

  Fly    92 YQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPEN 156
            .:||.||:.:.::|||.||||||:.|...|:..|.:||.||||:||||.|||...:.|||||.||
plant    81 KEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCHRDLKLEN 145

  Fly   157 LLLDHN--MHVKIADFGLSNMMLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYAL 219
            .|||.:  ..:||.|||.|...:.....:::.|:|.|.||||:..|.|.|...|:|||||.||.:
plant   146 TLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYIAPEVLLKKEYDGKVADVWSCGVTLYVM 210

  Fly   220 LCGTLPFDDEHVPTLFRK----IKSGIFPIPEY--LNKQVVNLVCQMLQVDPLKRANIEEIKKHE 278
            |.|..||:|...|..|||    |.:..:.||:|  ::.:..:|:.::...||.||.:|.||:.||
plant   211 LVGAYPFEDPEEPKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHE 275

  Fly   279 WFQKDLPAYL 288
            ||.|:|||.|
plant   276 WFLKNLPADL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 107/260 (41%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
OST1NP_567945.1 STKc_SnRK2-3 20..276 CDD:271135 106/259 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24343
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.