DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and SNRK2.2

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001190047.1 Gene:SNRK2.2 / 824214 AraportID:AT3G50500 Length:369 Species:Arabidopsis thaliana


Alignment Length:318 Identity:118/318 - (37%)
Similarity:172/318 - (54%) Gaps:37/318 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ANGQPLVKI--------GHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILNR-QKIKSLDVVGK 72
            |...|::.|        ..|.....:|:|.||..::...::|:..||||.:.| :||..     .
plant     4 ATNSPIMPIDLPIMHDSDRYDFVKDIGSGNFGVARLMTDRVTKELVAVKYIERGEKIDE-----N 63

  Fly    73 IRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIIS 137
            ::|||.|.:..|||:|::..:||.|||.:.::|||.:||||::.|...|:..|.:||.||||:||
plant    64 VQREIINHRSLRHPNIVRFKEVILTPSHLAIVMEYAAGGELYERICNAGRFSEDEARFFFQQLIS 128

  Fly   138 GVDYCHRHMIVHRDLKPENLLLDHN--MHVKIADFGLSNMM---LDGEFL----RTSCGSPNYAA 193
            ||.|||...|.|||||.||.|||.:  ..:||.|||.|.::   |....|    :::.|:|.|.|
plant   129 GVSYCHAMQICHRDLKLENTLLDGSPAPRLKICDFGYSKVLFISLKSSVLHSQPKSTVGTPAYIA 193

  Fly   194 PEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRK----IKSGIFPIPE--YLNKQ 252
            ||::..:.|.|...|:|||||.||.:|.|..||:|...|..:||    |.|..:.|||  :|:.:
plant   194 PEILLRQEYDGKLADVWSCGVTLYVMLVGAYPFEDPQEPRDYRKTIQRILSVTYSIPEDLHLSPE 258

  Fly   253 VVNLVCQMLQVDPLKRANIEEIKKHEWFQKDLPAYLFPSS--------IEQDSNVIDT 302
            ..:|:.::...||..|..|.||...:||.|:||..|...:        .||....:||
plant   259 CRHLISRIFVADPATRITIPEITSDKWFLKNLPGDLMDENRMGSQFQEPEQPMQSLDT 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 106/278 (38%)
UBA_AID_AMPKalpha 297..360 CDD:270521 2/6 (33%)
AMPKA_C 457..580 CDD:213378
SNRK2.2NP_001190047.1 PKc_like 22..285 CDD:304357 105/267 (39%)
S_TKc 23..286 CDD:214567 105/267 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24343
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.