DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and MARK4

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001186796.1 Gene:MARK4 / 57787 HGNCID:13538 Length:752 Species:Homo sapiens


Alignment Length:495 Identity:169/495 - (34%)
Similarity:249/495 - (50%) Gaps:87/495 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QPLVKIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILNRQKI--KSLDVVGKIRREIQNLKL 82
            ||  .:|:|.|..|:|.|.|.|||:..|.:|..:||:||:::.::  .||.   |:.||::.:|.
Human    53 QP--HVGNYRLLRTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPSSLQ---KLFREVRIMKG 112

  Fly    83 FRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMI 147
            ..||:|:||::||.|...::::|||.|.||:|||:|.||:::|.:||..|:||:|.|.|||:..|
Human   113 LNHPNIVKLFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNI 177

  Fly   148 VHRDLKPENLLLDHNMHVKIADFGLSNMMLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSC 212
            ||||||.||||||...::||||||.||....|..|.|.||||.|||||:..||.|.||||||||.
Human   178 VHRDLKAENLLLDAEANIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIWSL 242

  Fly   213 GVILYALLCGTLPFDDEHVPTLFRKIKSGIFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKH 277
            |||||.|:.|:||||..::..|..::..|.:.:|.|::....:::.:.|.::|.||..:|:|.|.
Human   243 GVILYTLVSGSLPFDGHNLKELRERVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCTLEQIMKD 307

  Fly   278 EWFQ-----KDLPAYLFPSSIEQDSNVIDTYAVAEVCTKFGVKETEVHNSLLSGDPHDQLAIAYH 337
            :|..     ::|..|..|   |:|..  ||..: ||....|....|:..||.| ..::::...| 
Human   308 KWINIGYEGEELKPYTEP---EEDFG--DTKRI-EVMVGMGYTREEIKESLTS-QKYNEVTATY- 364

  Fly   338 LIIDNKRFADDAANQINEINNFFVAGSPPPPPPPPVPQSSMDHQAP---LATV----TVGGGTSA 395
            |::..|                              .:...|..||   ||.|    ....|||:
Human   365 LLLGRK------------------------------TEEGGDRGAPGLALARVRAPSDTTNGTSS 399

  Fly   396 SSGTA------------------------TPVPPVAGGTPSSTIPIRPHPERIAPMRDRQLAMSV 436
            |.||:                        :|.|.....:|:||.......||:.   .|:.:.|.
Human   400 SKGTSHSKGQRSSSSTYHRQRRHSDFCGPSPAPLHPKRSPTSTGEAELKEERLP---GRKASCST 461

  Fly   437 QTSGGGAFPEKTARGGTPIKRAKWHLGIR---SQSKPNDI 473
            ..||....|..:....:.....|..:..|   |.|.||::
Human   462 AGSGSRGLPPSSPMVSSAHNPNKAEIPERRKDSTSTPNNL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 119/256 (46%)
UBA_AID_AMPKalpha 297..360 CDD:270521 12/62 (19%)
AMPKA_C 457..580 CDD:213378 6/20 (30%)
MARK4NP_001186796.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
STKc_MARK 58..310 CDD:270974 118/254 (46%)
S_TKc 59..310 CDD:214567 118/253 (47%)
UBA_MARK3_4 328..370 CDD:270590 12/46 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..614 26/120 (22%)
MARK4_C 654..752 CDD:213382
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.