DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and CG17698

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001036633.2 Gene:CG17698 / 4379919 FlyBaseID:FBgn0040056 Length:694 Species:Drosophila melanogaster


Alignment Length:371 Identity:110/371 - (29%)
Similarity:173/371 - (46%) Gaps:75/371 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VKIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILNRQKI------------KSLDVVGKIRR 75
            :::..|.|...:|.|::|.||:...:......|:|||:::::            |:...:.::.|
  Fly   278 LQLNQYRLMEQIGQGSYGLVKLAYSEEDSTHYAMKILSKKRLLRQAGLMRRGPRKATSPLDRVYR 342

  Fly    76 EIQNLKLFRHPHIIKLYQVISTP--SDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISG 138
            ||..||...||:::||.:|:..|  ..::|:.|.|..||:. .|.....|.|.:|...|::.:.|
  Fly   343 EIAVLKKLDHPNVVKLVEVLDDPLEDSLYMVFELVKQGEVL-RIPTDNPLSEKRAWSIFRESLLG 406

  Fly   139 VDY------------------CHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGEFL--- 182
            ::|                  .|...|:|.|:||.||||....||||||.|:.|     |||   
  Fly   407 LEYYTMLSSSAISLKRIFVYTVHHQKIIHADIKPGNLLLTEFGHVKIADLGVCN-----EFLGDD 466

  Fly   183 -----RTSCGSPNYAAPE-VISGK-LYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKS 240
                 .::.|:|.:.||| :|.|: .|.|...|:|:.|..||:|:.|.:||..:.||.|:.|||.
  Fly   467 ATISNGSTAGTPAFRAPETLIPGQNEYCGRAADVWALGATLYSLIFGNVPFLADSVPLLYEKIKQ 531

  Fly   241 GIFPIPEYLNKQVVNL---VCQMLQVDPLKRANIEEIKKHEWFQKDLPAYLFPSSIEQ------- 295
            .....||. :|...||   :.|||:.:|.:|..|.::|..:|...| ..|..|:..|.       
  Fly   532 DSVKFPEN-HKVTENLKSCIVQMLEKNPTQRITIPQLKTSKWVTSD-GDYPLPTEEENCCLVQVD 594

  Fly   296 ----DSNV-----IDTYAVAEVCTK---FG---VKETEVHNSLLSG 326
                ||.|     :||..:.:...|   ||   ||.....:|.|:|
  Fly   595 DEDIDSVVRSIPKLDTLILIKTMLKKHSFGNPFVKGCSGTSSSLAG 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 92/299 (31%)
UBA_AID_AMPKalpha 297..360 CDD:270521 12/41 (29%)
AMPKA_C 457..580 CDD:213378
CG17698NP_001036633.2 S_TKc 283..573 CDD:214567 92/296 (31%)
STKc_CAMKK 288..574 CDD:271020 91/292 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.