DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and Gm14151

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001091446.1 Gene:Gm14151 / 433486 MGIID:3651016 Length:640 Species:Mus musculus


Alignment Length:316 Identity:115/316 - (36%)
Similarity:182/316 - (57%) Gaps:14/316 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HYLLGATLGTGTFGKVKIGEHQITRVKVAVKILNRQKIKSLDVVGKIRREIQNLKLFRHPHIIKL 91
            ||.:..|||.||||.||:..|.:|:.|||:|||.:.:...|     ::.||:.:|...|||||||
Mouse    23 HYEILTTLGQGTFGDVKLANHLVTQTKVAIKILPQNRKNPL-----VQPEIEIMKSLDHPHIIKL 82

  Fly    92 YQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPEN 156
            ..:|.|..:||:::|:..||||.:.|.:.|.|.|.:..|.|:|::..:.|||...||||||||||
Mouse    83 LHIIDTTRNIFIVLEHAVGGELMNRIEEFGYLAEVECHRLFKQLVYALQYCHEKGIVHRDLKPEN 147

  Fly   157 LLLDHNMHVKIADFGLSNMMLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLC 221
            :||||..:||:.||||...::.|:.|.|.||:..|.|||:...:.|.|...|:||.||:||.:..
Mouse   148 ILLDHRGNVKLTDFGLGTKIIMGQKLVTFCGTLPYCAPELFEDRGYDGRATDVWSLGVVLYFMAT 212

  Fly   222 GTLPFDDEHVPTLFRKIKSGIFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHEWFQKDLPA 286
            |.|||:......:.:||.:|.:|....|:.::..::.::|.|:|.:|..:.:|.:.:|.:.|..|
Mouse   213 GCLPFNGYSYEAIKQKIIAGKYPRSFSLSPELWEVIAKLLTVNPGERPTVHDIARFKWLKPDNEA 277

  Fly   287 YLFPSSIEQDSNVIDTYAVAEVCTKFGV---KETEVHNSLLSGDPHDQLAIAYHLI 339
              .|:|:.::   |:::....:....||   ...|:..||.. ...||:...|.::
Mouse   278 --SPASLGEN---IESHPDPSIMVLMGVMGYNPGEIRESLRE-KKFDQVMATYLML 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 101/252 (40%)
UBA_AID_AMPKalpha 297..360 CDD:270521 9/46 (20%)
AMPKA_C 457..580 CDD:213378
Gm14151NP_001091446.1 STKc_AMPK-like 23..270 CDD:270905 101/251 (40%)
UBA_MARK_Par1 290..328 CDD:270522 8/39 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.