DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and CG14305

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster


Alignment Length:294 Identity:90/294 - (30%)
Similarity:148/294 - (50%) Gaps:26/294 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AAAAEAVAAGSANGQPLVKIGHYLLGATLGTGTFGKVKIGEHQITR---------VKVAVKILNR 61
            :|....:...|::...|.:.| |.:|..:|.|::..|      ||.         |.:|.||:::
  Fly     7 SAGIRQLGTRSSDVDALAQRG-YNVGHKIGEGSYATV------ITAGYADDHGHGVHLACKIIDK 64

  Fly    62 QKIKSLDVVGK-IRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQE 125
            .|..: |.|.| ..||::.|....|.:||:::.::.....||:.|.|...|:|..:|.:.|.:.|
  Fly    65 AKAPT-DFVNKFFPRELEILTKIDHSNIIQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDE 128

  Fly   126 HQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLD--GEFLR--TSC 186
            .|::.:|.|:...:.|.|...|.|||||.||:||...:::|:||||.:....|  |..::  |.|
  Fly   129 KQSKIWFFQMSKALKYLHNLDIAHRDLKCENILLSKRLNIKLADFGFARYCRDDNGREMKSETYC 193

  Fly   187 GSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGIF----PIPE 247
            ||..||||||:.|:.|.....|.||.||||:.::...:||||.::..|....::..|    .:.|
  Fly   194 GSAAYAAPEVVCGRPYDPKLADAWSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQE 258

  Fly   248 YLNKQVVNLVCQMLQVDPLKRANIEEIKKHEWFQ 281
            .::.|....|..:|:.:...|.|:.||....|.:
  Fly   259 TISAQAKATVSVLLEPEAHARWNLREILNCAWLR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 86/272 (32%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 86/271 (32%)
S_TKc 28..287 CDD:214567 85/265 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461619
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.