DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and Tssk2

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001012019.1 Gene:Tssk2 / 304181 RGDID:1304951 Length:358 Species:Rattus norvegicus


Alignment Length:318 Identity:117/318 - (36%)
Similarity:176/318 - (55%) Gaps:13/318 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YLLGATLGTGTFGKVKIGEHQITRVKVAVKILNRQKIKSLDVVGKIRREIQNLKLFRHPHIIKLY 92
            |::|..||.|::.|||....:..:..|||||::|:|..:..|...:.||:..|....|..|||.|
  Rat    12 YIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHRSIIKTY 76

  Fly    93 QVISTPSD--IFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPE 155
            ::..| ||  |:::||....|:|.::|...|.|.|..||:.|:|:.|.|.|||...:||||||.|
  Rat    77 EIFET-SDGRIYIVMELGVQGDLLEFIKCRGALHEDVARKMFRQLSSAVKYCHDLDVVHRDLKCE 140

  Fly   156 NLLLDHNMHVKIADFGLSNMML-DGE----FLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVI 215
            |||||.:.::|::|||.|...| ||.    ..:|.|||..||||||:.|..|.....||||.|||
  Rat   141 NLLLDKDFNIKLSDFGFSKRCLRDGSGRIVLSKTFCGSAAYAAPEVLQGIPYQPKVYDIWSLGVI 205

  Fly   216 LYALLCGTLPFDDEHVPTLFR--KIKSGIFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHE 278
            ||.::||::|:||..:..:.|  |.....||..:.|..:..:|:.::||.|..:|.:|:||..|.
  Rat   206 LYIMVCGSMPYDDSDIKKMLRIQKEHRVDFPRSKNLTGECKDLIYRILQPDVNRRLHIDEILSHS 270

  Fly   279 WFQKDLPAYLFPSSIEQDSNVIDTY-AVAEVCTKFGVKETEVHNSLLSGDPHDQLAIA 335
            |.|...|..:..:|.:::..  ..| |..::.|:.|.:.....:..|...|..:|.:|
  Rat   271 WL
QPPKPKAMSSASFKREGE--GKYRADCKLDTRPGSRPEHRPDHKLGSKPQHRLLVA 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 105/260 (40%)
UBA_AID_AMPKalpha 297..360 CDD:270521 8/40 (20%)
AMPKA_C 457..580 CDD:213378
Tssk2NP_001012019.1 STKc_TSSK1_2-like 10..272 CDD:271067 105/260 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.