DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and Tssk3

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001007651.1 Gene:Tssk3 / 297891 RGDID:1359231 Length:268 Species:Rattus norvegicus


Alignment Length:256 Identity:91/256 - (35%)
Similarity:154/256 - (60%) Gaps:5/256 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YLLGATLGTGTFGKVKIGEHQITRVKVAVKILNRQKIKSLDVVGKIRREIQNLKLFRHPHIIKLY 92
            |.||.|:|.||:.|||....:..:.|||:||:::.......:...:.||:|.::...|.:||::|
  Rat    10 YQLGKTIGEGTYSKVKEAFSKKHQRKVAIKIIDKMGGPEEFIQRFLPRELQIVRTLDHKNIIRVY 74

  Fly    93 QVI-STPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPEN 156
            ::: |....|:::||...||::||.::..|.|.|.:|:..|:|::..:.|||...:.|||||.||
  Rat    75 EMLESADGKIYLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVEAIRYCHGCGVAHRDLKCEN 139

  Fly   157 LLLDHNMHVKIADFGLSNMMLDG--EFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYAL 219
            .|| ...::|:.|||.:.::...  |..:|.|||..||||||:.|..:...:.|:||.||:||.:
  Rat   140 ALL-QGFNLKLTDFGFAKVLPKSRRELSQTFCGSTAYAAPEVLQGIPHDSKKGDVWSMGVVLYVM 203

  Fly   220 LCGTLPFDDEHVPTLFRKIKSGI-FPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHEW 279
            ||.:|||||..:|.:..:.:.|: ||....::.:..:|:.::|:.|.:.|.:|||:..|.|
  Rat   204 LCASLPFDDTDIPKMLWQQQKGVSFPTHLGISTECQDLLKRLLEPDMILRPSIEEVSWHPW 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 91/256 (36%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
Tssk3NP_001007651.1 STKc_TSSK3-like 9..265 CDD:271065 91/256 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.