DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and Tssk6

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001099548.1 Gene:Tssk6 / 290670 RGDID:1559764 Length:273 Species:Rattus norvegicus


Alignment Length:269 Identity:92/269 - (34%)
Similarity:153/269 - (56%) Gaps:7/269 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NGQPLVKIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILNRQKIKSLDVVGK-IRREIQNLK 81
            :|..|:....|.||.|:|.|::.|||:...:..:..||:|:::|::... |.|.| :.||:..|:
  Rat     2 SGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPP-DFVNKFLPRELSILR 65

  Fly    82 LFRHPHIIKLYQVIST-PSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRH 145
            ..|||||:.:::.|.. ...::::|| .:..:|...:.::|::...|||..|.||...|.|.|.|
  Rat    66 GVRHPHIVHVFEFIEVCNGKLYIVME-AAATDLLQAVQRNGRIPGSQARELFSQIAGAVRYLHDH 129

  Fly   146 MIVHRDLKPENLLLD-HNMHVKIADFGLSNMMLDGEFLRTS-CGSPNYAAPEVISGKLYAGPEVD 208
            .:||||||.||:||. ....||:.|||..........|.|: |||..||:|||:.|..|...:.|
  Rat   130 HLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYD 194

  Fly   209 IWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGI-FPIPEYLNKQVVNLVCQMLQVDPLKRANIE 272
            :||.||:||.::.|.:||||..:..|.|:.|.|: :|....|:::..:|:.::||..|..|.:..
  Rat   195 VWSLGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPDGLELSERCKSLIAELLQFSPSARPSAG 259

  Fly   273 EIKKHEWFQ 281
            ::.::.|.:
  Rat   260 QVARNGWLR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 89/259 (34%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
Tssk6NP_001099548.1 STKc_TSSK6-like 11..267 CDD:271066 89/257 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.