DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and TSSK4

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001171668.1 Gene:TSSK4 / 283629 HGNCID:19825 Length:338 Species:Homo sapiens


Alignment Length:291 Identity:103/291 - (35%)
Similarity:158/291 - (54%) Gaps:33/291 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YLLGATLGTGTFGKVKIGEHQITRVKVAVKILNRQKIKSLDVVGK-IRREIQNLKLFRHPHIIKL 91
            |.:|..:|.|::|.|....:...:|.|||||::::| .|.|.:.| :.||||.:|:.||.::|..
Human    25 YEVGKAIGHGSYGSVYEAFYTKQKVMVAVKIISKKK-ASDDYLNKFLPREIQVMKVLRHKYLINF 88

  Fly    92 YQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVH------- 149
            |:.|.:.|.:::|:|...||::.::|.::|...|..|.::|.|:..|:.|.|...|||       
Human    89 YRAIESTSRVYIILELAQGGDVLEWIQRYGACSEPLAGKWFSQLTLGIAYLHSKSIVHRLMPSLS 153

  Fly   150 ---RDLKPENLLLDHNMHVKIADFGLSNMMLDGE----------------FLRTSCGSPNYAAPE 195
               ||||.||||||...:|||:|||.:.|:...:                ..:|.|||..||.||
Human   154 AAGRDLKLENLLLDKWENVKISDFGFAKMVPSNQPVGCSPSYRQVNCFSHLSQTYCGSFAYACPE 218

  Fly   196 VISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGI-FPIPEYLNKQVVNLVCQ 259
            ::.|..|.....|.||.|||||.|:...|||||.::..|.|:.:..: ||....::::..||:.|
Human   219 ILRGLPYNPFLSDTWSMGVILYTLVVAHLPFDDTNLKKLLRETQKEVTFPANHTISQECKNLILQ 283

  Fly   260 MLQVDPLKRANIEEIKKHEW---FQKDLPAY 287
            ||: ...|||.|.:|.|..|   ||.:.|.:
Human   284 MLR-QATKRATILDIIKDSWVLKFQPEQPTH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 100/282 (35%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
TSSK4NP_001171668.1 STKc_TSSK4-like 24..303 CDD:271064 99/279 (35%)
S_TKc 25..303 CDD:214567 99/279 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.