DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and AT5G57565

DIOPT Version :10

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001318820.1 Gene:AT5G57565 / 2746216 AraportID:AT5G57565 Length:178 Species:Arabidopsis thaliana


Alignment Length:155 Identity:65/155 - (41%)
Similarity:89/155 - (57%) Gaps:27/155 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDL 152
            |:...|||.|.:.|.::|||||||:|.|.:.:. |::|..||:.|||:|..|||||...:.||||
plant    19 ILHFSQVIGTKTKICIVMEYVSGGQLSDRLGRQ-KMKESDARKLFQQLIDAVDYCHNRGVYHRDL 82

  Fly   153 KPENLLLDHNMHVKIADFGLSNMMLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSC----- 212
            ||:|||||...:::::|||||.:...|:.|.|:||||.|.|||        ...|:|:.|     
plant    83 KPQNLLLDSKGNLQVSDFGLSAVPKSGDMLSTACGSPCYIAPE--------ENVVEIYKCSNCVF 139

  Fly   213 --------GVILYALLC-----GTL 224
                    |.|:...||     |||
plant   140 KFHKRSKHGYIVDLKLCFHMFVGTL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 65/155 (42%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
AT5G57565NP_001318820.1 Protein Kinases, catalytic domain <19..>125 CDD:473864 53/106 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.