DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and Y38H8A.4

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_502595.1 Gene:Y38H8A.4 / 178314 WormBaseID:WBGene00012638 Length:331 Species:Caenorhabditis elegans


Alignment Length:269 Identity:98/269 - (36%)
Similarity:151/269 - (56%) Gaps:19/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LGTGTFGKVKIGEHQITRVKVAVKILN----RQKIKSLDVVGK-IRREIQNLKLFRHPHIIKLYQ 93
            ||:|::.:|........:::||.|::|    |:|.   |.:.| :.||.:.:||.:|.::.:||:
 Worm    42 LGSGSYSRVARATWGDKKLEVAAKVINITPTREKD---DYIKKFLPREKEIVKLLKHDNVCRLYE 103

  Fly    94 VISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLL 158
            :||.|..|..:.|:.:||:|...:.|...:.|..|:..|:|.|:.:.:...:.|||||||.||:.
 Worm   104 MISFPDHIIFVTEFCAGGDLLRKMKKIKTMSEENAKFTFRQFIAALMHLQSYNIVHRDLKCENIF 168

  Fly   159 LDHNMHVKIADFGLSNMMLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGT 223
            ||...:||:.|||.|.::..||...|.|||..|.|||::.|:.|:|..||:||.|||||.:|.||
 Worm   169 LDKYENVKLGDFGFSRILKPGEKSGTFCGSRAYVAPEILRGREYSGNAVDVWSTGVILYIMLVGT 233

  Fly   224 LPFDDEHVPT------LFRKIKSGIFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHEWFQK 282
            :||||.. ||      |..|||.|........:|.   |:.::||.....|...:.|.:.||. |
 Worm   234 MPFDDRD-PTRMIERQLAHKIKFGKTCTASIHSKA---LILEILQPHAPNRPTYKAICESEWL-K 293

  Fly   283 DLPAYLFPS 291
            :.|.|:.|:
 Worm   294 NQPYYMKPN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 93/256 (36%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
Y38H8A.4NP_502595.1 PKc_like 38..292 CDD:389743 93/256 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163987
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.