DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPKalpha and NIM1K

DIOPT Version :9

Sequence 1:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_699192.1 Gene:NIM1K / 167359 HGNCID:28646 Length:436 Species:Homo sapiens


Alignment Length:334 Identity:122/334 - (36%)
Similarity:185/334 - (55%) Gaps:29/334 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILNR----QKIKSLDVVGKIRREIQNLKLFR 84
            :||.|.:...:|:|.|.:||:|.|.:|:.|||:|||::    ||.:.|     :.|||.:::...
Human    70 RIGFYRIRGEIGSGNFSQVKLGIHSLTKEKVAIKILDKTKLDQKTQRL-----LSREISSMEKLH 129

  Fly    85 HPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVH 149
            ||:||:||:|:.|.|.:.::|||..|||||..|...|||.|.:::..|.||:|.|.:.|.:.|:|
Human   130 HPNIIRLYEVVETLSKLHLVMEYAGGGELFGKISTEGKLSEPESKLIFSQIVSAVKHMHENQIIH 194

  Fly   150 RDLKPENLLLDHNMHVKIADFGLSNMMLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGV 214
            ||||.||:....|..||:.|||.|.:...||.|.|.||||.|||||:...:.|.|..||||:.||
Human   195 RDLKAENVFYTSNTCVKVGDFGFSTVSKKGEMLNTFCGSPPYAAPELFRDEHYIGIYVDIWALGV 259

  Fly   215 ILYALLCGTLPFDDEHVPTLFRKIKSGIFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHEW 279
            :||.::.||:||..|.|..|.:.|..|.:.:|.::::....|:..:||..|.:|..|:.|...||
Human   260 LLYFMVTGTMPFRAETVAKLKKSILEGTYSVPPHVSEPCHRLIRGVLQQIPTERYGIDCIMNDEW 324

  Fly   280 ------------FQKDLPAYLF-PSSIEQDSNVIDTYAVAEVCTKFGVKETEVHNSLLSGDPHDQ 331
                        ||.| |.:|. .|:::::.|     .|.......|:.|..:.|: ...|....
Human   325 MQGVPYPTPLEPFQLD-PKHLSETSTLKEEEN-----EVKSTLEHLGITEEHIRNN-QGRDARSS 382

  Fly   332 LAIAYHLII 340
            :...|.:|:
Human   383 ITGVYRIIL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 108/270 (40%)
UBA_AID_AMPKalpha 297..360 CDD:270521 8/44 (18%)
AMPKA_C 457..580 CDD:213378
NIM1KNP_699192.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..55
STKc_NIM1 71..325 CDD:270977 107/258 (41%)
S_TKc 74..325 CDD:214567 105/255 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.