DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chb and C27C12.1

DIOPT Version :9

Sequence 1:NP_524651.2 Gene:chb / 43901 FlyBaseID:FBgn0021760 Length:1491 Species:Drosophila melanogaster
Sequence 2:NP_510464.1 Gene:C27C12.1 / 182961 WormBaseID:WBGene00007771 Length:264 Species:Caenorhabditis elegans


Alignment Length:294 Identity:62/294 - (21%)
Similarity:118/294 - (40%) Gaps:74/294 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1223 PTDDAKVITVSINMAE-------NGELILASNLMESEVVRVALTLTKDQPVELLQTSLTNLGICI 1280
            |.|:.:.:..|:..|:       ||:..|.  |...::...:....|  |..:|..:|.......
 Worm    14 PPDEVEKLLHSMKQAKEELETLGNGDESLF--LCPQKITHCSTVSWK--PNNVLAPALPKQNALN 74

  Fly  1281 KGGNCELPNKH-FRSIMRMLLNILEAEHTDVVIAGLHVLSKIMRSNKMRHNWMHFLELILLKIIQ 1344
            ..||.:|.::: ..|.:..||...|....|.|        ::.|.|        :.|:       
 Worm    75 FNGNEQLSHENEAHSEIPSLLTFQEKGEEDTV--------EVTRDN--------YNEI------- 116

  Fly  1345 CYQHSKEALRDIDSMIPRI--APSLPLDLSINIVNPVI-ATGEFPTN---------------LCA 1391
                  :.:.|..|:.|.:  :|.:.:|.|:......| .|.:|..:               ||.
 Worm   117 ------DTVEDFRSIEPALENSPKILVDDSMEATQTFIEETNDFQNDTVHSLDGTLEIENRRLCL 175

  Fly  1392 IKILLEVTEHHGSEITDAHLDIVFPNLA----RSADDTQSMVRKAAVFCIVKLYFVLGEEKVKPK 1452
            :.:|:|:.|...|...|..|::: |:||    ::.:...|:.||.|::|:|.:...:|.|:::..
 Worm   176 LGMLVEMKEICKSVKVDLLLNLI-PDLAPVAVQACNSASSLSRKEAIYCLVYMVKQVGAEEMEKY 239

  Fly  1453 LSVLNPSKVRLLNVYIEKQRNCISGGGSSTKNSS 1486
            |..|..:|..||.:||::          |:|:.|
 Worm   240 LEPLTTAKRTLLQIYIDR----------SSKDDS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chbNP_524651.2 HEAT repeat 50..78 CDD:293787
CLASP_N <74..211 CDD:289144
HEAT repeat 90..120 CDD:293787
HEAT_2 129..>210 CDD:290374
HEAT repeat 131..154 CDD:293787
HEAT repeat 165..195 CDD:293787
CLASP_N 316..536 CDD:289144
C27C12.1NP_510464.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2956
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D62708at33208
OrthoFinder 1 1.000 - - FOG0001668
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.