DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Crg-1 and foxg1c

DIOPT Version :10

Sequence 1:NP_726887.1 Gene:Crg-1 / 43900 FlyBaseID:FBgn0021738 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001038680.2 Gene:foxg1c / 571323 ZFINID:ZDB-GENE-050419-26 Length:379 Species:Danio rerio


Alignment Length:42 Identity:19/42 - (45%)
Similarity:26/42 - (61%) Gaps:2/42 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KTSRPKKPPFTYTELIEYALEDKGE--LTVSGIYQWISHLLP 50
            |.|:|.||||:|..||..|:....|  ||::|||::|....|
Zfish    84 KKSKPDKPPFSYNALIMMAIRQSPERRLTLNGIYEFIMGNFP 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Crg-1NP_726887.1 Forkhead 17..>46 CDD:459732 14/30 (47%)
foxg1cNP_001038680.2 None

Return to query results.
Submit another query.