DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E23 and Y45F10C.6

DIOPT Version :9

Sequence 1:NP_524648.3 Gene:E23 / 43895 FlyBaseID:FBgn0020445 Length:1017 Species:Drosophila melanogaster
Sequence 2:NP_001023470.2 Gene:Y45F10C.6 / 3565462 WormBaseID:WBGene00044256 Length:118 Species:Caenorhabditis elegans


Alignment Length:88 Identity:23/88 - (26%)
Similarity:34/88 - (38%) Gaps:25/88 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   743 VLSSRNFREAKPRMLSKLNWFQTIGLALMAGAI---WFQLPRTEEFLHDLQGWMFFSQTYWMLFA 804
            ::.||...|.:   |:.:|..:|..|.....||   :.|.|..||  .|      |.|.      
 Worm    41 IVESRGRVELR---LTSVNRHETPNLTQFVFAIIVPFIQSPNEEE--ED------FHQV------ 88

  Fly   805 LFGALNSFPSEREVVSKERRSGA 827
               .|::.|...|:  :.||.||
 Worm    89 ---TLDTPPDREEL--RTRRGGA 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E23NP_524648.3 ABCG_EPDR 350..572 CDD:213180
3a01204 363..1009 CDD:273361 23/88 (26%)
ABC2_membrane 744..943 CDD:279410 23/87 (26%)
Y45F10C.6NP_001023470.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0061
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.