Sequence 1: | NP_524648.3 | Gene: | E23 / 43895 | FlyBaseID: | FBgn0020445 | Length: | 1017 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101191.1 | Gene: | Abca4 / 310836 | RGDID: | 1309445 | Length: | 2290 | Species: | Rattus norvegicus |
Alignment Length: | 219 | Identity: | 60/219 - (27%) |
---|---|---|---|
Similarity: | 104/219 - (47%) | Gaps: | 39/219 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 358 LNVLHNERQILSDVSGFVSPCEVLAIMGPSGSGKTTLLDCLSGQRHIDSGSVFLNREPL---TKK 419
Fly 420 WRRRIGYVLQEEIFFPQLTLRETVVYTALLRLPESMPRAEKMRQVDHILEALELGCCQQTKFGDY 484
Fly 485 LNRGLSGGEKKRANIACELLTNPLLMLLDEPTSGLDSHSAISLMKVLKRYAQLEQKTIVISVHQP 549
Fly 550 SSQMFHM------FDKLLLLHQGR 567 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E23 | NP_524648.3 | ABCG_EPDR | 350..572 | CDD:213180 | 60/219 (27%) |
3a01204 | 363..1009 | CDD:273361 | 58/214 (27%) | ||
ABC2_membrane | 744..943 | CDD:279410 | |||
Abca4 | NP_001101191.1 | rim_protein | 1..2249 | CDD:130324 | 60/219 (27%) |
ABC_subfamily_A | 907..1126 | CDD:213230 | 60/219 (27%) | ||
ABC_subfamily_A | 1915..2135 | CDD:213230 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |