DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E23 and Abca4

DIOPT Version :9

Sequence 1:NP_524648.3 Gene:E23 / 43895 FlyBaseID:FBgn0020445 Length:1017 Species:Drosophila melanogaster
Sequence 2:NP_001101191.1 Gene:Abca4 / 310836 RGDID:1309445 Length:2290 Species:Rattus norvegicus


Alignment Length:219 Identity:60/219 - (27%)
Similarity:104/219 - (47%) Gaps:39/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 LNVLHNERQILSDVSGFVSPCEVLAIMGPSGSGKTTLLDCLSGQRHIDSGSVFLNREPL---TKK 419
            ||:...|.||             .|.:|.:|:||||.|..|:|.....||:|.:..:.:   ...
  Rat   927 LNITFYENQI-------------TAFLGHNGAGKTTTLSILTGLLPPTSGTVLIGGKDIEISLDA 978

  Fly   420 WRRRIGYVLQEEIFFPQLTLRETVVYTALLRLPESMPRAEKMRQVDHILEALELGCCQQTKFGDY 484
            .|:.:|...|..|.|..||:.|.:::.|.|:   .....|...:::.:||...|...:..:..| 
  Rat   979 VRQSLGMCPQHNILFHHLTVAEHILFYAQLK---GRSWEEARLEMEAMLEDTGLHHKRNEEAQD- 1039

  Fly   485 LNRGLSGGEKKRANIACELLTNPLLMLLDEPTSGLDSHSAISLMKVLKRYAQLEQKTIVISVHQP 549
                ||||.:::.::|...:.:..:::|||||||:|.:|..|:..:|.:|.  ..:||::|.|  
  Rat  1040 ----LSGGMQRKLSVAIAFVGDSKVVVLDEPTSGVDPYSRRSIWDLLLKYR--SGRTIIMSTH-- 1096

  Fly   550 SSQMFHM------FDKLLLLHQGR 567
                 ||      .|::.::.|||
  Rat  1097 -----HMDEADLLGDRIAIISQGR 1115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E23NP_524648.3 ABCG_EPDR 350..572 CDD:213180 60/219 (27%)
3a01204 363..1009 CDD:273361 58/214 (27%)
ABC2_membrane 744..943 CDD:279410
Abca4NP_001101191.1 rim_protein 1..2249 CDD:130324 60/219 (27%)
ABC_subfamily_A 907..1126 CDD:213230 60/219 (27%)
ABC_subfamily_A 1915..2135 CDD:213230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.