DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E23 and Abca12

DIOPT Version :9

Sequence 1:NP_524648.3 Gene:E23 / 43895 FlyBaseID:FBgn0020445 Length:1017 Species:Drosophila melanogaster
Sequence 2:XP_237242.6 Gene:Abca12 / 301482 RGDID:1304586 Length:2595 Species:Rattus norvegicus


Alignment Length:364 Identity:80/364 - (21%)
Similarity:153/364 - (42%) Gaps:48/364 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 HSLQLTFQNLNVLHNERQILSDVSGFVSPCEVLAIMGPSGSGKTTLLDCLSGQRHIDSGSVFLNR 413
            |.|..|:|   ::|.:...::::|..:...|...::|.:|:||||:...|:|.....||::.:..
  Rat  2257 HRLTKTYQ---LIHKKIIAVNNISLGIPAGECFGLLGVNGAGKTTIFKMLTGDIIPSSGNILIRN 2318

  Fly   414 EP----LTKKWRRRIGYVLQEEIFFPQLTLRETVVYTALLRLPESMPRAEKMRQVDHILEALELG 474
            :.    ........:||..||:.....:|:.|.:.:.|.:   ..:|..:....|..:|..|.| 
  Rat  2319 KSGSLGHVDSHSSLVGYCPQEDALDDLVTVEEHLYFYARV---HGIPEKDIKETVHKLLRRLHL- 2379

  Fly   475 CCQQTKFGDYLNRGLSGGEKKRANIACELLTNPLLMLLDEPTSGLDSHSAISLMKVLKRYAQLEQ 539
                ..:.|......|.|.|::.:.|..|:..|.::|||||:||:|..|...|.:::..  :::.
  Rat  2380 ----MAYKDRSTSMCSYGTKRKLSTALALIGKPSILLLDEPSSGMDPKSKRHLWRIISE--EVQN 2438

  Fly   540 KTIVISVHQPSSQMFHMFDKLLLLHQGRTAYFGDVQNIYRHFEDIGVTIKPHYNPADFVLEQLKS 604
            |..||.......:...:..:|.::..||....|.:|:|...| ..|.|:|.|.......:|.|..
  Rat  2439 KCSVILTSHSMEECEALCTRLAIMVNGRFQCIGSLQHIKSRF-GRGFTVKVHLKNNKVSMENLTK 2502

  Fly   605 HPDIR-EKLFIAAKESHGNYLNRNCITSSHHNQVSVSGA-------KGKKQADSI--------LI 653
            ...:. .|.::  |:.|.:.|       .:|..|:..|.       :..|.|.:|        .:
  Rat  2503 FMQLHFPKTYL--KDQHLSML-------EYHVPVTAGGVANIFDLLETNKTALNITNFLVSQTTL 2558

  Fly   654 DDIINNYYNQRSNRHHHQYENLHHTSNGCRVEEDEEAAQ 692
            :::..|:...:.:     |||:..:|.|..:..|.:..|
  Rat  2559 EEVFINFAKDQKS-----YENVDTSSQGSTISVDSQEDQ 2592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E23NP_524648.3 ABCG_EPDR 350..572 CDD:213180 51/225 (23%)
3a01204 363..1009 CDD:273361 75/350 (21%)
ABC2_membrane 744..943 CDD:279410
Abca12XP_237242.6 ABC2_membrane_3 <1006..1267 CDD:289468
NosY <1108..1269 CDD:224196
ZnuC 1346..1570 CDD:224046
ABC_subfamily_A 1350..1565 CDD:213230
ABC2_membrane_3 <1913..2174 CDD:289468
CcmA 2253..2567 CDD:224054 73/332 (22%)
ABC_subfamily_A 2254..2477 CDD:213230 54/232 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.