DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E23 and Abca17

DIOPT Version :9

Sequence 1:NP_524648.3 Gene:E23 / 43895 FlyBaseID:FBgn0020445 Length:1017 Species:Drosophila melanogaster
Sequence 2:NP_001026807.1 Gene:Abca17 / 287112 RGDID:1560494 Length:1773 Species:Rattus norvegicus


Alignment Length:266 Identity:73/266 - (27%)
Similarity:125/266 - (46%) Gaps:23/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 LTFQNLNVLHNERQIL---SDVSGFVSPCEVLAIMGPSGSGKTTLLDCLSGQRHIDSGSVFLN-- 412
            |..:.|:.::.|:..|   :.||..|...|...::|.:|:|||::.:.|:.::.|.||..|:.  
  Rat  1369 LVVKELSKVYKEKVPLLAVNKVSFVVKEKECFGLLGLNGAGKTSIFNMLTREQPITSGDAFVKGF 1433

  Fly   413 --REPLTK--KWRRRIGYVLQEEIFFPQLTLRETVVYTALLRLPESMPRAEKMRQVDHILEALEL 473
              |..:.|  :|   |||..:.:.....:|.||.:|..|.:|   .:|.......||.|||.| |
  Rat  1434 NIRTDMAKVQQW---IGYCPEFDALLNFMTGREMLVMHARIR---GIPECHIKTCVDMILENL-L 1491

  Fly   474 GCCQQTKFGDYLNRGLSGGEKKRANIACELLTNPLLMLLDEPTSGLDSHSAISLMKVLKRYAQLE 538
            .|.    :.|.|.:..|.|.|:..:.|..||..|.::|||||::|:|..:...:...:.|..: .
  Rat  1492 MCV----YADKLVKTYSDGNKRVLSTAIALLGEPTVILLDEPSTGMDPVARRLVWDAVGRVRE-S 1551

  Fly   539 QKTIVISVHQPSSQMFHMFDKLLLLHQGRTAYFGDVQNIYRHF-EDIGVTIKPHYNPADFVLEQL 602
            .|||||:.|. ..:...:..:|.::.||:....|..|::...| ....:..|........:||:.
  Rat  1552 GKTIVITSHS-MEECEALCTRLAIMVQGQFKCLGSPQHLKSRFGSGYSLQAKVRRKWQQQMLEEF 1615

  Fly   603 KSHPDI 608
            |:..|:
  Rat  1616 KAFVDL 1621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E23NP_524648.3 ABCG_EPDR 350..572 CDD:213180 65/227 (29%)
3a01204 363..1009 CDD:273361 71/256 (28%)
ABC2_membrane 744..943 CDD:279410
Abca17NP_001026807.1 ABC2_membrane_3 <262..464 CDD:289468
ABC_subfamily_A 525..746 CDD:213230
drrA 543..834 CDD:130256
ABC2_membrane_3 913..1255 CDD:289468
CcmA 1369..1682 CDD:224054 73/266 (27%)
ABC_subfamily_A 1369..1590 CDD:213230 67/233 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1690..1773
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.