DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E23 and Abcd4

DIOPT Version :9

Sequence 1:NP_524648.3 Gene:E23 / 43895 FlyBaseID:FBgn0020445 Length:1017 Species:Drosophila melanogaster
Sequence 2:NP_033018.2 Gene:Abcd4 / 19300 MGIID:1349217 Length:606 Species:Mus musculus


Alignment Length:227 Identity:62/227 - (27%)
Similarity:92/227 - (40%) Gaps:53/227 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 NERQILSDVSGFVSPCEVLAIMGPSGSGKTTLLDCLSGQRHIDSGSV------------FLNREP 415
            :::.::.|:|..:...:.|.|.|.:|:|||:||..|.|......|||            ||.::|
Mouse   399 SDKPLIKDLSLKICEGQSLLITGNTGTGKTSLLRVLGGLWEGMKGSVQMLADFGPHGVLFLPQKP 463

  Fly   416 LTKKWRRRIGYVLQEEIFFPQLTLRETVVYTALLRLPESMPRAEKMRQVDHILEALEL------- 473
                             ||...||||.|:|......|:|....:     :.|:..|||       
Mouse   464 -----------------FFTDGTLREQVIYPLKEIYPDSGSADD-----ERIVRFLELAGLSSLV 506

  Fly   474 ----GCCQQTKFGDYLNRGLSGGEKKRANIACELLTNPLLMLLDEPTSGLDSHSAISLMKVLKRY 534
                |..||..:..|  ..||.||.:|.:.|......|...:|||.||.|...:...|.::    
Mouse   507 ARTGGLDQQVDWNWY--DVLSPGEMQRLSFARLFYLQPKYAVLDEATSALTEEAESELYRI---- 565

  Fly   535 AQLEQKTIVISVHQPSSQMFHMFDKLLLLHQG 566
            .|....|.:...|:||.:.||.:  :|.||.|
Mouse   566 GQQLGMTFISVGHRPSLEKFHSW--VLRLHGG 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E23NP_524648.3 ABCG_EPDR 350..572 CDD:213180 62/227 (27%)
3a01204 363..1009 CDD:273361 62/227 (27%)
ABC2_membrane 744..943 CDD:279410
Abcd4NP_033018.2 YddA 10..606 CDD:226646 62/227 (27%)
ABC_membrane_2 16..294 CDD:284003
ABCD_peroxisomal_ALDP 387..598 CDD:213190 62/227 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3107
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.