DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E23 and pmp-3

DIOPT Version :9

Sequence 1:NP_524648.3 Gene:E23 / 43895 FlyBaseID:FBgn0020445 Length:1017 Species:Drosophila melanogaster
Sequence 2:NP_001256607.1 Gene:pmp-3 / 179968 WormBaseID:WBGene00004060 Length:688 Species:Caenorhabditis elegans


Alignment Length:309 Identity:69/309 - (22%)
Similarity:129/309 - (41%) Gaps:73/309 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 TDNLTSSNGLANIGKSILVDAKSNSPASLSYHFEK------SAAANQQKQHH------------- 329
            :|.|.:....:.:..|::|.|......|.|.|.::      |...::|::..             
 Worm   377 SDCLETDRPPSTVPSSVVVIASDEDDKSASRHMQEIHGKQMSLERDEQEEEEAQYLLGGKTGQED 441

  Fly   330 ---------NINICNSHHPHHHSQNQPQHSLQLTFQNLNVLHNERQILSDVSGFVSPCEVLAIMG 385
                     .::......|:.||        .|..|.|::     ||:..        :.|.|.|
 Worm   442 DWPDDGVAITVDSATLSPPNDHS--------HLIVQLLSL-----QIIQG--------QTLLITG 485

  Fly   386 PSGSGKTTLLDCLSGQRHIDSGSVFLNREPLTKKWRRRIG--YVLQEEIFFP--QLTLRETVVY- 445
            .||.||::||...:|..|..||.:..:       |||...  :.|.::.:||  ..|||:.:|| 
 Worm   486 DSGCGKSSLLRMFAGLWHCSSGKMDCH-------WRRLTSNLFFLAQKPYFPSGNTTLRQQIVYP 543

  Fly   446 TALLRLPESMPRAEKMRQ---VDHILEALELGCCQQTKFGDYLNRGLSGGEKKRANIACELLTNP 507
            ...|::.:.:.|..::.:   ::|::|  ..|........|:: :.||.||.:|.::|....|.|
 Worm   544 VKALQVDKDVARITQILEWVKMEHLVE--RCGGLDTPVEWDWM-KTLSPGELQRLSLARVFYTKP 605

  Fly   508 LLMLLDEPTSGLDSHSAISLMKVLKRYAQLEQKTIVISV-HQPSSQMFH 555
            .::.|||.||.:.....:::.:.|:     |:|...:|: |:.|.:.||
 Worm   606 RIVFLDESTSAIGFELEMAIYRKLQ-----EEKITFVSIGHRYSLKQFH 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E23NP_524648.3 ABCG_EPDR 350..572 CDD:213180 56/215 (26%)
3a01204 363..1009 CDD:273361 53/202 (26%)
ABC2_membrane 744..943 CDD:279410
pmp-3NP_001256607.1 ABC_membrane_2 34..314 CDD:284003
YddA 37..655 CDD:226646 69/309 (22%)
ABCD_peroxisomal_ALDP 450..662 CDD:213190 59/236 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3107
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.