DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sif and ARHGEF39

DIOPT Version :9

Sequence 1:NP_001261446.1 Gene:sif / 43892 FlyBaseID:FBgn0085447 Length:2734 Species:Drosophila melanogaster
Sequence 2:XP_011516359.1 Gene:ARHGEF39 / 84904 HGNCID:25909 Length:351 Species:Homo sapiens


Alignment Length:267 Identity:61/267 - (22%)
Similarity:110/267 - (41%) Gaps:38/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1462 ELVDTERTYVKHLNNLLEHYLEPMKRETFLSNAEINALFGNIHEIVTFQRQFLQNLEESLDLEPD 1526
            ||::|||.|.:.|..:..::|..:|.:..|...|..||||:...|....::.|..||..      
Human    29 ELLETERRYQEQLGLVATYFLGILKAKGTLRPPERQALFGSWELIYGASQELLPYLEGG------ 87

  Fly  1527 FNKFEHCGQFRNVLFAIGSAFLYYVNHFKLYSSFCASHSKAQKVLHPN-EGNHALQEFLAARNPK 1590
                  |.         |.....:..|.:||:.|.|:..::|..|... :.|...:.|:..:..:
Human    88 ------CW---------GQGLEGFCRHLELYNQFAANSERSQTTLQEQLKKNKGFRRFVRLQEGR 137

  Fly  1591 QQHSS-TLESYLIKPIQRILKYPLLLQQMRNLTDTRADEHVHLCEALKGMEKVAEHINEM-QRIH 1653
            .:... .|:..|..|:||:.:|..|:..:...|...:.:|..|..|.:.:.:.|:.::.: |:..
Human   138 PEFGGLQLQDLLPLPLQRLQQYENLVVALAENTGPNSPDHQQLTRAARLISETAQRVH
TIGQKQK 202

  Fly  1654 EEYGAIFDHLFR-QHQKSCKQPIDLSPGDLLYYGGVEWLNISDFLGKIKKGLELHAMCFVFKSAV 1717
            .:     .||.| |...|.:|...|:.|......|  ||.:....|:.:.     .|.|:| :.|
Human   203 ND-----QHLRRVQALLSGRQAKGLTSGRWFLRQG--WLLVVPPHGEPRP-----RMFFLF-TDV 254

  Fly  1718 VFLCKER 1724
            :.:.|.|
Human   255 LLMAKPR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sifNP_001261446.1 WH1 35..144 CDD:214674
PH1_Tiam1_2 860..985 CDD:269937
PH 873..974 CDD:278594
TIAM1_RBD 1141..1219 CDD:176413
PDZ_signaling 1221..1308 CDD:238492
RhoGEF 1456..1647 CDD:238091 42/186 (23%)
PH2_Tiam1_2 1650..1823 CDD:269957 19/76 (25%)
PH 1693..1812 CDD:278594 7/32 (22%)
ARHGEF39XP_011516359.1 RhoGEF 27..195 CDD:295373 42/186 (23%)
PH-like 225..>269 CDD:302622 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.