DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sif and c1orf131

DIOPT Version :9

Sequence 1:NP_001261446.1 Gene:sif / 43892 FlyBaseID:FBgn0085447 Length:2734 Species:Drosophila melanogaster
Sequence 2:XP_002931536.1 Gene:c1orf131 / 733757 XenbaseID:XB-GENE-940972 Length:273 Species:Xenopus tropicalis


Alignment Length:161 Identity:38/161 - (23%)
Similarity:61/161 - (37%) Gaps:26/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   741 HKRSPWDSLPSLRQDSSLNDSGYKSARAD------------SLEQRAEFIRQDSLRSEYLSDRES 793
            ||:....|:|.::|..:...|. ||.:.|            |..:|...:..|||:.|..:..:|
 Frog    29 HKKKKTQSVPEIQQSPAAPISN-KSEKEDFELNVAIPNTCSSHRKRNVTLFFDSLKEEMCNRTKS 92

  Fly   794 RYGIVQQASIESTDSRMCYLTSSE-ISDDDRMSLTTAVSDEDDGESVMASPYKAKATGTAASSFN 857
                 .:||....:|..|...|.| ::...|....:.:..|...|:|:....| :..|....|||
 Frog    93 -----TEASSTVANSNQCSENSIEVVTFRSRKKAKSQIEPESCSETVLIDKEK-EENGQKGQSFN 151

  Fly   858 CTGA---VRKAGFLSVKKWLLRKKHQIELAR 885
            ...|   :.|.|....:|   .|:...|..|
 Frog   152 FEKARLEIHKFGITGYRK---EKQRTFEQER 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sifNP_001261446.1 WH1 35..144 CDD:214674
PH1_Tiam1_2 860..985 CDD:269937 7/29 (24%)
PH 873..974 CDD:278594 3/13 (23%)
TIAM1_RBD 1141..1219 CDD:176413
PDZ_signaling 1221..1308 CDD:238492
RhoGEF 1456..1647 CDD:238091
PH2_Tiam1_2 1650..1823 CDD:269957
PH 1693..1812 CDD:278594
c1orf131XP_002931536.1 DUF4602 114..232 CDD:373798 16/70 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3519
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.